Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c4jA_

Fold library idPDB HeaderMoleculeTitle
c6c4jA_2.53PDB header: oxidoreductaseChain: A: PDB Molecule: udp-glucose 6-dehydrogenase;


Added to library: Sat May 19 08:33:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FEIKKICCIGAGYVGGPTCSVIRVTVEPGLKEVVESCRGKNLSTNIDDAIKELVFISVNTPTKTYGMGKG
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)





STT



TTTTTTTT



T






B

SSTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence RALDLKYIEACARRIVQNSNGYKIVTEKSTVPVRAAESIRRIFDANTKPNLQVLSNPEFLAEGTAIKDLK
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TSB

T

S

S


TTT









TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence NPDRVLIGGDETPEGQRAVQALCAVYEHWVPREKILTTNTWSSELSKLAANAFLAQRISSINSISALCEA
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) S
S

SSTTTS
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence TGADVEEVATAIGMDQRIGNKFLKASVGFGGSCFQKDVLNLVYLCEALNLPEVARYWQQVIDMNDYQRRR
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S

TSTTT
SSS



S


SSSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence FASRIIDSLFNTVTDKKIAILGFAFKKDTGDTRESSSIYISKYLMDEGAHLHIYDPKVPREQIVVDLSHQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT

TT


SSSSS



TT
TT

SSS
T


 .........360.........370.........380.........390.........400.........410.........420
Sequence VSRLVTISKDPYEACDGAHAVVICTEWDMFKELDYERIHKKMLKPAFIFDGRRVLDGLHNELQTIGFQIE
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SSTT
S
S

GGGGG

TS
SS
SSSTTTT
T
 ......
Sequence TIGKKV
Predicted secondary structure



SS confidence





Known secondary structure (DSSP) TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D