Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c49A_

Fold library idPDB HeaderMoleculeTitle
c6c49A_1.85PDB header: oxidoreductaseChain: A: PDB Molecule: alcohol dehydrogenase;


Added to library: Sat Jan 27 09:29:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NNTIQAYAAMQAGEKLVPYKFDAGELQPHQVEVKVEYCGLCHSDISVLNNEWHSTVYPVVAGHEIIGRIV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

BSSTT




S

TT
TTTTS


SSB



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ALGSEAKGLQIGQRVGIGWTAESCQACDECIGGQQVLCTGENIATIVGHAGGFADKVRAGWQWAIPLPED
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TT

S

TT

S

S
STT
GGG
SSS
TTSSS

SSBSGGGS

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LDPESAGPLLCGGITVFDPLLKHKIQATHHVGVIGIGGLGHIAIKLLKAWGCEITAFSSNPDKTEELKAM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
GGGGTTT

TTS

ST
S
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence GADHVVNSRDTEAVKAQKGKFDLLLSTVNVNWRAFISTLAPNGSLHFLGLTLEPVPVSVGSLIDGAKSVT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T
STT
TTTT





T
S


S




T
 .........290.........300.........310.........320.........330........
Sequence GSPTGSPAALRQLLKFAARKKIAPQIELFPMSQLNEAIERLHSGQARYRIVLKADFAE
Predicted secondary structure


















SS confidence

























































Known secondary structure (DSSP)

S

S




GGGT

SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D