Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c49A_

Fold library idPDB HeaderMoleculeTitle
c6c49A_1.85PDB header: oxidoreductaseChain: A: PDB Molecule: alcohol dehydrogenase;


Added to library: Sat Jan 27 09:29:03 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NNTIQAYAAMQAGEKLVPYKFDAGELQPHQVEVKVEYCGLCHSDISVLNNEWHSTVYPVVAGHEIIGRIV
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

BSSTT




S

TT
TTTTS


SSB



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ALGSEAKGLQIGQRVGIGWTAESCQACDECIGGQQVLCTGENIATIVGHAGGFADKVRAGWQWAIPLPED
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)
TT

S

TT

S

S
STT
GGG
SSS
TTSSS

SSBSGGGS

TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence LDPESAGPLLCGGITVFDPLLKHKIQATHHVGVIGIGGLGHIAIKLLKAWGCEITAFSSNPDKTEELKAM
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
GGGGTTT

TTS

ST
S
GGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence GADHVVNSRDTEAVKAQKGKFDLLLSTVNVNWRAFISTLAPNGSLHFLGLTLEPVPVSVGSLIDGAKSVT
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) T
STT
TTTT





T
S


S




T
 .........290.........300.........310.........320.........330........
Sequence GSPTGSPAALRQLLKFAARKKIAPQIELFPMSQLNEAIERLHSGQARYRIVLKADFAE
Predicted secondary structure


















SS confidence

























































Known secondary structure (DSSP)

S

S




GGGT

SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D