Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c3oE_

Fold library idPDB HeaderMoleculeTitle
c6c3oE_3.90PDB header: transport proteinChain: E: PDB Molecule: atp-binding cassette sub-family c member 8;


Added to library: Sat Feb 3 14:31:46 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PLAFCGSENHSAAYRVDQGVLNNGCFVDALNVVPHVFLLFITFPILFIGWGFPGHNLRWILTFMLLFVLV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)


SS

STTTTTTT

SSGGGSTS

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence CEIAEGILSDGVTESHHLHLYMPAGMAFMAAVTSVVYYHNIETSNFPKLLIALLVYWTLAFITKTIKFVK
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) TTSS
SS

GGGTTTTT
SS
T
 .........150.........160.........170.........180.........190.........200.........210
Sequence FLDHAIGFSQLRFCLTGLLVILYGMLLLVEVNVIRVNYQRLCEAFDAQVRKDAIWQALSHAFGRRLVLSS
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TS


ST



T
 .........220.........230.........240.........250.........260.........270.........280
Sequence TFRILADLLGFAGPLCIFGIVDHLGKANAYVLAVLLFLALLLQRTFLQASYYVAIETGINLRGAIQTKIY
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) SS



 .........290.........300.........310.........320.........330.........340.........350
Sequence NKIMHLSTSNLSMGEMTAGQICNLVAIDTNQLMWFFFLCPNLWAMPVQIIVGVILLYYILGVSALIGAAV
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) B
TTS

TT
SS

TT
 .........360.........370.........380.........390.........400.........410.........420
Sequence IILLAPVQYFVATKLSQAQRSTLEYSNERLKQTNEMLRGIKLLKLYAWENIFRTRVETTRRKEMTSLRAF
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) S
TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence AIYTSISIFMNTAIPIAAVLITFVGHVPSVAFASLSLFHILVTPLFLLSSVVRSTVKALVSVQKLSEFLS
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) TT


TT
 .........500.........510.........520.........530.........540.........550.........560
Sequence SAEIRCCVQIMGGYFTWTPDGIPTLSNITIRIPRGQLTMIVGQVGCGKSSLLLAALGEMQKVSGAVFWSR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S
B



S
SSTTS

S

TT
STTSSTTTTT
S



 .........570.........580.........590.........600.........610.........620.........630
Sequence GPVAYASQKPWLLNATVEENIIFESPFNKQRYKMVIEACSLQPDIDILPHGDQTQIGERGINLSGGQRQR
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)






SS



SSBTSS


T
TSTTGGG
BBSSSSB


 .........640.........650.........660.........670.........680.........690.........700
Sequence ISVARALYQHANVVFLDDPFSALDIHLSDHLMQAGILELLRDDKRTVVLVTHKLQYLPHADWIIAMKDGT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) T

SS
SSS

SSS

S
GGGSTT
STT
 .........710.........720.........730.........740.........750.........760.........770
Sequence IQREGTLKDFQRSECQLFEHWKTLEIPWRACAKYLSSAGILLLSLLVFSQLLKHMVLVAIDYWLAKWTDT
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
SSTTTTS
GGG

TS
STT

 .........780.........790.........800.........810.........820.........830.........840
Sequence VYAMVFTVLCSLGIVLCLVTSVTVEWTGLKVAKRLHRSLLNRIILAPMRFFETTPLGSILNRFSSDCNTI
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TTS
S
T
 .........850.........860.........870.........880.........890.........900.........910
Sequence DQHIPSTLECLSRSTLLCVSALAVISYVTPVFLVALLPLAIVCYFIQKYFRVASRDLQQLDDTTQLPLLS
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP)
GGG
 .........920.........930.........940.........950.........960.........970.........980
Sequence HFAETVEGLTTIRAFRYEARFQQKLLEYTDSNNIASLFLTAANRWLEVRMEYIGACVVLIAAVTSISNSL
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) TTTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence HRELSAGLVGLGLTYALMVSNYLNWMVRNLADMELQLGAVKRIHGLLKTEAESYEGLLAPSLIPKNWPDQ
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) S


SS







SS
TTTS
TT


S
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence GKIQIQNLSVRYDSSLKPVLKHVNALIAPGQKIGICGRTGSGKSSFSLAFFRMVDTFEGHIIIDGIDIAK
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

B
SSTTS

SB
S



SS


TTSSGGGT
S


TTSTT
 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence LPLHTLRSRLSIILQDPVLFSGTIRFNLDPERKCSDSTLWEALEIAQLKLVVKALPGGLDAIITEGGENF
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S
SS
SS



S
SSS
S
TTT
TSSSSS
S
GGGTTS
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence SQGQRQLFCLARAFVRKTSIFIMDEATASIDMATENILQKVVMTAFADRTVVTIAHRVHTILSADLVIVL
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS

SSTTTT


SSS
S
TTTGGG
SS
 .........1270.........1280.........1290
Sequence KRGAILEFDKPEKLLSRKDSVFASFVRADK
Predicted secondary structure










SS confidence





























Known secondary structure (DSSP) TT


B
S
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D