Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c23C_

Fold library idPDB HeaderMoleculeTitle
c6c23C_3.90PDB header: gene regulationChain: C: PDB Molecule: histone-lysine n-methyltransferase ezh2;


Added to library: Sat Jan 27 08:21:16 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KRVKSEYMRLRQLKRFRRADEVKSMFSSNRQKILERTEILNQEWKQRRIQPVHILTSVSSLRGTRECSVT
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
TTS










SS
SSS



 .........80.........90.........100.........110.........120.........130.........140
Sequence SDLDFPTQVIPLKTLNAVASVPIMYSWSPLQQNFMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGK
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
SSS























SS






SS
SS




SSSTTS
TTTTT
 .........150.........160.........170.........180.........190...
Sequence VHGDRECGFINDEIFVELVNALGQYSDKIFEAISSMFPDKGTAEELKEKYKEL
Predicted secondary structure














SS confidence




















































Known secondary structure (DSSP)
TT
SSSS


T

STTTSST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D