Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c0vA_

Fold library idPDB HeaderMoleculeTitle
c6c0vA_3.40PDB header: transport proteinChain: A: PDB Molecule: multidrug resistance protein 1;


Added to library: Sat Feb 3 18:22:13 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SVFSMFRYSNWLDKLYMVVGTLAAIIHGAGLPLMMLVFGEMTDIFAMNLEEDMTRYAYYYSGIGAGVLVA
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)
TT
S
TT

TTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence AYIQVSFWCLAAGRQIHKIRKQFFHAIMRQEIGWFDVHDVGELNTRLTDDVSKINEGIGDKIGMFFQSMA
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) TS
S
GGGSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TFFTGFIVGFTRGWKLTLVILAISPVLGLSAAVWAKILSSFTDKELLAYAKAGAVAEEVLAAIRTVIAFG
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP)
SSTTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence GQKKELERYNKNLEEAKRIGIKKAITANISIGAAFLLIYASYALAFWYGTTLVLSGEYSIGQVLTVFFSV
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)
T

S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LIGAFSVGQASPSIEAFANARGAAYEIFKIIDNKPSIDSYSKSGHKPDNIKGNLEFRNVHFSYPSRKEVK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T


SS
SS



B

S



S


SS
TT

 .........360.........370.........380.........390.........400.........410.........420
Sequence ILKGLNLKVQSGQTVALVGNSGCGKSTTVQLMQRLYDPTEGMVSVDGQDIRTINVRFLREIIGVVSQEPV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
S
SS


TTS
TTSS

SBS

TTTTTB
TT
SS

 .........430.........440.........450.........460.........470.........480.........490
Sequence LFATTIAENIRYGRENVTMDEIEKAVKEANAYDFIMKLPHKFDTLVGERGAQLSGGQKQRIAIARALVRN
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)

SSBTT
SS

T
SSSSTT

B

TTS
SS

 .........500.........510.........520.........530.........540.........550.........560
Sequence PKILLLDQATSALDTESEAVVQVALDKARKGRTTIVIAHRLSTVRNADVIAGFDDGVIVEKGNHDELMKE
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
SSTTSSS
T
TTS
S
ST
STT
T
 .........570.........580.........590.........600.........610.........620.........630
Sequence KGIYFKLVTMQTVSFWRIMKLNLTEWPYFVVGVFCAIINGGLQPAFAIIFSKIIGVFTRIDDPETKRQNS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TS


T
S
TTSSS
SST
 .........640.........650.........660.........670.........680.........690.........700
Sequence NLFSLLFLALGIISFITFFLQGFTFGKAGEILTKRLRYMVFRSMLRQDVSWFDDPKNTTGALTTRLANDA
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTS
TSSS

 .........710.........720.........730.........740.........750.........760.........770
Sequence AQVKGAIGSRLAVITQNIANLGTGIIISFIYGWQLTLLLLAIVPIIAIAGVVEMKMLSGQALKDKKELEG
Predicted secondary structure
SS confidence





































































Known secondary structure (DSSP) ST

SSTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence SGKIATEAIENFRTVVSLTQEQKFEHMYAQSLQVPYRNSLRKAHIFGITFSFTQAMMYFSYAGCFRFGAY
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TT
ST
 .........850.........860.........870.........880.........890.........900.........910
Sequence LVAHKLMSFEDVLLVFSAVVFGAMAVGQVSSFAPDYAKAKISAAHIIMIIEKTPLIDSYSTEGLMPNTLE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TSS
TTTT


SS
SS


S


S


 .........920.........930.........940.........950.........960.........970.........980
Sequence GNVTFGEVVFNYPTRPDIPVLQGLSLEVKKGQTLALVGSSGCGKSTVVQLLERFYDPLAGKVLLDGKEIK
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)



SSS
SS
S
TT

STTSSSTTSS

SSSSBTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence RLNVQWLRAHLGIVSQEPILFDCSIAENIAYGDNSRVVSQEEIVRAAKEANIHAFIESLPNKYSTKVGDK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TS


SS



SSBTTS
SS


T
STTGGG
B

TT
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence GTQLSGGQKQRIAIARALVRQPHILLLDQATSALDTESEKVVQEALDKAREGRTCIVIAHRLSTIQNADL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S
SS
TT

SSTTSS

T
TTS
S
SS
 .........1130.........1140.........1150....
Sequence IVVFQNGRVKEHGTHQQLLAQKGIYFSMVSVQAG
Predicted secondary structure








SS confidence

































Known secondary structure (DSSP) TT
TTSTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D