Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6c0bA_

Fold library idPDB HeaderMoleculeTitle
c6c0bA_2.50PDB header: toxinChain: A: PDB Molecule: toxin b;


Added to library: Sat May 19 08:29:44 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STNIRINLDSNTRSFIVPIKLSYSFYGSGGTYALSLSQYNMGINIELSESDVWIIDVDNVVRDVTIESDK
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SS






SSS

SS



TT

TTTSTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence IKKGDLIEGILSTLSIEENKIILNSHEINFSGEVNGSNGFVSLTFSILEGINAIIEVDLLSKSYKLLISG
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TTGGGG
TTTTS


TTT
TTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence ELKILMLNSNHIQQKIDYIGFNSELQKNIPYSFVDSEGKENGFINGSTKEGLFVSELPDVVLISKVYMDD
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)
TTT

TTT
S
SS
TTT

SS
TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SKPSFGYYSNNLKDVKVITKDNVNILTGYYLKDDIKISLSLTLQDEKTIKLNSVHLDESGVAEILKFMNR
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) SS

SS
TTSSS
TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence KGSTNTSDSLMSFLESMNIKSIFVNFLQSNIKFILDANFIISGTTSIGQFEFICDENNNIQPYFIKFNTL
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTS

SSTTGGGS
TT



TT
TT

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence ETNYTLYVGNRQNMIVEPNYDSSTVINFSQKYLYGIDSCVNKVVISPNIYTDEINITPVYETNNTYPEVI
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TTTTTT





SSGGGTTTTTT




TT




TTSS


 .........430.........440.........450.........460.........470.........480.........490
Sequence VLDANYINEKINVNINDLSIRYVWSNDGNDFILMSTSEENKVSQVKIRFVNVFKDKTLANKLSFNFSDKQ
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)




SSS

S
GGG
TT


SSS
S


TTTTT

SSS
 .........500......
Sequence DVPVSEIILSFTPSYY
Predicted secondary structure



SS confidence















Known secondary structure (DSSP) SS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D