Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bzfG_

Fold library idPDB HeaderMoleculeTitle
c6bzfG_2.29PDB header: dna binding proteinChain: G: PDB Molecule: sporulation-specific protein 16;


Added to library: Sat Feb 17 08:19:48 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHENLYFSEFFWDVQKIQEISNVEEHSVVKCVTVNTSRLISQLNEELQDEESGVNFIVTQLQLLINNVYE
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)

GGGT






TTSSS


S
 .........80.........90.........100.........110.........120.........130.........140
Sequence KIQKSHRSLMINLNFTRLKFSIAYWDILLERSLDLINGPSKTGARYFITEVTPVDRSRYVENMDEFIDFE
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


S


S
T

ST


SS


TTT

 .........150.........160.........170....
Sequence ILIKQIIFDLFKKNGIPDLSRFHNLESLVVAFNE
Predicted secondary structure








SS confidence

































Known secondary structure (DSSP) TT



TT
SST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D