Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bzfD_

Fold library idPDB HeaderMoleculeTitle
c6bzfD_2.29PDB header: dna binding proteinChain: D: PDB Molecule: protein zip2;


Added to library: Sat Feb 17 08:20:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ENKCIAVNENKVIENQKVIQSLKNSHLDLIEQSYFGECDFIINHSTCVYKIQASRFMQLRNNGSLHYDAV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

GGGTTTT


TT

SS

STTGGGTT
B
TTSSBTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence NDLLTEFQRVIIIVEFSEIIQDVDPDLFWIKLYLLNSRVDVFFIHETTDFFIDWMYFIARWAFSYNDEKE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
S
T
GGGT



TTSS


B




S
 .........150.........160.........170.........180.........190.........200.
Sequence KNIANADILLDLGFNILLVRIFQTYSLEEFFMAIIKEESKAVKMLTVSQMTRLKKLLTLEW
Predicted secondary structure


























SS confidence




























































Known secondary structure (DSSP)

TT



TTT

TT
TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D