Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bzfD_

Fold library idPDB HeaderMoleculeTitle
c6bzfD_2.29PDB header: dna binding proteinChain: D: PDB Molecule: protein zip2;


Added to library: Sat Feb 17 08:20:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ENKCIAVNENKVIENQKVIQSLKNSHLDLIEQSYFGECDFIINHSTCVYKIQASRFMQLRNNGSLHYDAV
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP)

GGGTTTT


TT

SS

STTGGGTT
B
TTSSBTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence NDLLTEFQRVIIIVEFSEIIQDVDPDLFWIKLYLLNSRVDVFFIHETTDFFIDWMYFIARWAFSYNDEKE
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
S
T
GGGT



TTSS


B




S
 .........150.........160.........170.........180.........190.........200.
Sequence KNIANADILLDLGFNILLVRIFQTYSLEEFFMAIIKEESKAVKMLTVSQMTRLKKLLTLEW
Predicted secondary structure


























SS confidence




























































Known secondary structure (DSSP)

TT



TTT

TT
TTS




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D