Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bzcA_

Fold library idPDB HeaderMoleculeTitle
c6bzcA_2.05PDB header: isomeraseChain: A: PDB Molecule: glucose-6-phosphate isomerase;


Added to library: Sat Jan 13 08:21:41 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMSLNTINPTETKAWAQLKEHFAETDFDLKQLFTEDKSRFSEFSIQKENLLFDFSKNLVDKKAFQLLLAL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SS



GGGST



T
TTTTT
TTSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence AEECHLNDAIEKMFTGDLINQTENRAVLHTALRNFGEEKIVVNGKSIDEDVQRVLNQMKIFSEKIISGEH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTT


BTTTTB


TGGGGSTTSS

TT
T
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGFSGKEITDVVNIGIGGSDLGPVMVCSALKHYRTRLNTHFVSNVDGNHIAEVVKNLNPETTLFIIASKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) B
TTS
B



GGGTTGGG

S


SSTT

TTS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FTTQETMTNALSAKEWFLKAGKEEDVAKHFVALSTNIEAVKNFGIAEENIFEFWDWVGGRYSLWSAIGLS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S

TTS
GGGS
TTT

GGG

TTS
GGG
TTTGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence IVLAVGYDNFEKLLRGAQDTDKHFRNTEFKNNIPVLMGVLGVWYRNFFDASSYAILPYSQYLDRFAAYLQ
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
GGG
TS


SSGGGTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence QGDMESNGKSVDRNGEFVDYETGPIIWGEPGTNGQHAFYQLIHQGTELIPADFIAYAKANNNLSDHQDKL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


B
TTS
B
SS

S



TTGGGGTTSS




SS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence MSNFFAQTEALAFGKTKEQVITELKASGKNEEEIAFLTNFKTFTGNTPTNSFIFEELTPFTLGQLIAFYE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
B
TT

TGGG
B






 .........500.........510.........520.........530.........540........
Sequence HKIFVQGVIWNIFSFDQWGVELGKALANKILPELENTAEITSHDSSTNGLINFYKKHK
Predicted secondary structure




















SS confidence

























































Known secondary structure (DSSP) T

SS

GGGS
S


SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D