Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bzcA_

Fold library idPDB HeaderMoleculeTitle
c6bzcA_2.05PDB header: isomeraseChain: A: PDB Molecule: glucose-6-phosphate isomerase;


Added to library: Sat Jan 13 08:21:41 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HMSLNTINPTETKAWAQLKEHFAETDFDLKQLFTEDKSRFSEFSIQKENLLFDFSKNLVDKKAFQLLLAL
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

SS



GGGST



T
TTTTT
TTSS

 .........80.........90.........100.........110.........120.........130.........140
Sequence AEECHLNDAIEKMFTGDLINQTENRAVLHTALRNFGEEKIVVNGKSIDEDVQRVLNQMKIFSEKIISGEH
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TTTT


BTTTTB


TGGGGSTTSS

TT
T
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence KGFSGKEITDVVNIGIGGSDLGPVMVCSALKHYRTRLNTHFVSNVDGNHIAEVVKNLNPETTLFIIASKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) B
TTS
B



GGGTTGGG

S


SSTT

TTS
SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FTTQETMTNALSAKEWFLKAGKEEDVAKHFVALSTNIEAVKNFGIAEENIFEFWDWVGGRYSLWSAIGLS
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) S

TTS
GGGS
TTT

GGG

TTS
GGG
TTTGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence IVLAVGYDNFEKLLRGAQDTDKHFRNTEFKNNIPVLMGVLGVWYRNFFDASSYAILPYSQYLDRFAAYLQ
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP) S
GGG
TS


SSGGGTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence QGDMESNGKSVDRNGEFVDYETGPIIWGEPGTNGQHAFYQLIHQGTELIPADFIAYAKANNNLSDHQDKL
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)


B
TTS
B
SS

S



TTGGGGTTSS




SS

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence MSNFFAQTEALAFGKTKEQVITELKASGKNEEEIAFLTNFKTFTGNTPTNSFIFEELTPFTLGQLIAFYE
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
B
TT

TGGG
B






 .........500.........510.........520.........530.........540........
Sequence HKIFVQGVIWNIFSFDQWGVELGKALANKILPELENTAEITSHDSSTNGLINFYKKHK
Predicted secondary structure




















SS confidence

























































Known secondary structure (DSSP) T

SS

GGGS
S


SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D