Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bz0C_

Fold library idPDB HeaderMoleculeTitle
c6bz0C_1.83PDB header: oxidoreductaseChain: C: PDB Molecule: dihydrolipoyl dehydrogenase;


Added to library: Sat Jan 6 09:16:58 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALLDSSHRYEDTVHHLA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



STT



TT

STSSSG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAGKKVEFVPHEGETQILEPK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGT


S




TT

GGG
SSS



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)





TTS


SSS
T

SS

S

STT


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FLPMADKALSKEYQKILTKQGLDIRIGAKVSGTEVNGREVTVKYTQAGEDKEQTFDKLIVCVGRKAYAEG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSTTS
T

S
TTTTS
S


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LLAEDSGIKLTERGLVEVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIIS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TB
TTS


TTT


TT
B
SSTT
GGGSSS


TT





TTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence IIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAAS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
SSS

TT

STT
T



TTT
BTT
 .........430.........440.........450.........460........
Sequence DIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAI
Predicted secondary structure


















SS confidence















































Known secondary structure (DSSP) TT
BTS


SS
STTT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D