Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bz0C_

Fold library idPDB HeaderMoleculeTitle
c6bz0C_1.83PDB header: oxidoreductaseChain: C: PDB Molecule: dihydrolipoyl dehydrogenase;


Added to library: Sat Jan 6 09:16:58 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FDLVVIGGGPGGYEAAIRAAQLGFKVACIEKRIHNGKPSLGGTCLNVGCIPSKALLDSSHRYEDTVHHLA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)



STT



TT

STSSSG
 .........80.........90.........100.........110.........120.........130.........140
Sequence DHGITTGEVNFDLAKLLARKDKIVDQLTGGIDQLLKGNGIEWLKGTGKLLAGKKVEFVPHEGETQILEPK
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) GGT


S




TT

GGG
SSS



S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YVILASGSVPVNIPVAPVDQDIIVDSTGALNFPEVPKRLGVIGAGVIGLELGSVWRRLGAEVVVFEAMDA
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)





TTS


SSS
T

SS

S

STT


SSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FLPMADKALSKEYQKILTKQGLDIRIGAKVSGTEVNGREVTVKYTQAGEDKEQTFDKLIVCVGRKAYAEG
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSTTS
T

S
TTTTS
S


TT
 .........290.........300.........310.........320.........330.........340.........350
Sequence LLAEDSGIKLTERGLVEVNDHCATSVEGVYAIGDLVRGPMLAHKAMEEGVMAVERIHGHAAQVNYDTIIS
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP) TB
TTS


TTT


TT
B
SSTT
GGGSSS


TT





TTS

 .........360.........370.........380.........390.........400.........410.........420
Sequence IIYTHPEAAWVGLTEEQAKEKGHEVKTGQFGFAVNGRALAAGEGAGFVKFVADAKTDRLLGMHVIGPAAS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
SSS

TT

STT
T



TTT
BTT
 .........430.........440.........450.........460........
Sequence DIVHQGMIALEFVSSVEDLQLMTFGHPTFSEVVHEAALAVDGRAIHAI
Predicted secondary structure


















SS confidence















































Known secondary structure (DSSP) TT
BTS


SS
STTT

TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D