Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bywB_

Fold library idPDB HeaderMoleculeTitle
c6bywB_2.05PDB header: unknown functionChain: B: PDB Molecule: goxa;


Added to library: Sat Feb 17 08:23:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNVQYLVTQQELEQLLEEAFGGNVINEISQIKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


S

SS
SSGGG


SSTTTTTT
TT


B

TS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KLKFKQEEIETITGLLGLSHLVPQQQLSRSLDNLEDIVQQIKGALLKVLSDHYLHAVKKQAQNFYIYKCD
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)





TTTS
T


TT
B


 .........150.........160.........170.........180.........190.........200.........210
Sequence EQGNPVEKLKLTDGDKVTWRVEVANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRRNPN
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT





TT

GGGSB

SS
GGGG


S
BSSS
TTSS



BSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VITNSLRKQLVISSQGSVSSDNNTQVPLRGKFPANLQERHNVLQGSIECDNEGVLRFYAGNGISQALSPS
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) S
SGGG
TTB


S






TT





SSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPPDYAPQIEPIVTMYDMVSGAAL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



SSSB
TTS


TTS

STTT



S
TTS

SSBT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KEQDLDNLTTQFSDVFPILYRLYRMQWVNQADFTDNAVNTQIRELNSELGFAQLLDNSASAKSLREGIFN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) BGGGGGG


BGGGT
S
TT
GGGGG

SGGGT
 .........430.........440.........450.........460.........470.........480.........490
Sequence QFRNPLFDQDIDVDDPSNEWVSNSRIIPSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAIPPFM
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) TB

TT

SS



SS




SS


S





S


B


B
TTTTSTT
GGGB



 .........500.........510.........520.........530.........540.........550.........560
Sequence YQHLQNWAAGDFSVTQVEKESANTIEELGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPMR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) T

B

TT
SS
S
TSB



SS
SS

GGGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence HNLIYSQNDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGHVIAVDNVTASIDPNSDAAWLWRST
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) SGGG
SSSS

TT

B
TTGGG
TTTT


SS
TSTTSTTGGGTSB
 .........640.........650.........660.........670.........680.........690.........700
Sequence PGDLTKWMGIPWQSDAASCQAVYTPEDFPIPSWAANLPVHVLPLARYNKFKDSQSADLPEINGMTHSIAQ
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TTTTTTTS
BSTSSB


SS
SS

B


SS
S
BTTTSS
TT

SSTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence GMSEETFEHLRLEQFSQRLDWLHTADLGFVGYHAEGGYTNGLIQMVSQWKNMAMVMARPVENPGSSGIPN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
T

GGGSS
SS

STT


SGGGS

S

TTS


S
 .........780
Sequence VVYVAYSQAD
Predicted secondary structure


SS confidence









Known secondary structure (DSSP)
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D