Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bywB_

Fold library idPDB HeaderMoleculeTitle
c6bywB_2.05PDB header: unknown functionChain: B: PDB Molecule: goxa;


Added to library: Sat Feb 17 08:23:00 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence CQYKIYPPLGIARVGNGPAIKPLSLSTPEVPWAHLYDTNVQYLVTQQELEQLLEEAFGGNVINEISQIKT
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)


S

SS
SSGGG


SSTTTTTT
TT


B

TS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence KLKFKQEEIETITGLLGLSHLVPQQQLSRSLDNLEDIVQQIKGALLKVLSDHYLHAVKKQAQNFYIYKCD
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)





TTTS
T


TT
B


 .........150.........160.........170.........180.........190.........200.........210
Sequence EQGNPVEKLKLTDGDKVTWRVEVANKKSFWYDYNNALDLSLHTQGSGNLSKNVSKHRLAPAMTAKRRNPN
Predicted secondary structure

















































SS confidence





































































Known secondary structure (DSSP) TT





TT

GGGSB

SS
GGGG


S
BSSS
TTSS



BSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence VITNSLRKQLVISSQGSVSSDNNTQVPLRGKFPANLQERHNVLQGSIECDNEGVLRFYAGNGISQALSPS
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) S
SGGG
TTB


S






TT





SSTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence SLNTDFADNSNWFDDICDGRVTAVVELKNGDTFEIQDEQSSAWVATTPPDYAPQIEPIVTMYDMVSGAAL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)



SSSB
TTS


TTS

STTT



S
TTS

SSBT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KEQDLDNLTTQFSDVFPILYRLYRMQWVNQADFTDNAVNTQIRELNSELGFAQLLDNSASAKSLREGIFN
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) BGGGGGG


BGGGT
S
TT
GGGGG

SGGGT
 .........430.........440.........450.........460.........470.........480.........490
Sequence QFRNPLFDQDIDVDDPSNEWVSNSRIIPSKDETNIAAKPATSSLKLPFYPNDGIDYPGSPVQWFAIPPFM
Predicted secondary structure


























































SS confidence





































































Known secondary structure (DSSP) TB

TT

SS



SS




SS


S





S


B


B
TTTTSTT
GGGB



 .........500.........510.........520.........530.........540.........550.........560
Sequence YQHLQNWAAGDFSVTQVEKESANTIEELGLFYSEQFKNSPNSALLCARGALDALYGGGFHPGVELTWPMR
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) T

B

TT
SS
S
TSB



SS
SS

GGGG
 .........570.........580.........590.........600.........610.........620.........630
Sequence HNLIYSQNDYVSSVTPEINLLGLREFRLKQDLQGLNSPNMYQDFGHVIAVDNVTASIDPNSDAAWLWRST
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP) SGGG
SSSS

TT

B
TTGGG
TTTT


SS
TSTTSTTGGGTSB
 .........640.........650.........660.........670.........680.........690.........700
Sequence PGDLTKWMGIPWQSDAASCQAVYTPEDFPIPSWAANLPVHVLPLARYNKFKDSQSADLPEINGMTHSIAQ
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) TTTTTTTS
BSTSSB


SS
SS

B


SS
S
BTTTSS
TT

SSTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence GMSEETFEHLRLEQFSQRLDWLHTADLGFVGYHAEGGYTNGLIQMVSQWKNMAMVMARPVENPGSSGIPN
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) S
T

GGGSS
SS

STT


SGGGS

S

TTS


S
 .........780
Sequence VVYVAYSQAD
Predicted secondary structure


SS confidence









Known secondary structure (DSSP)
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D