Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6by9A_

Fold library idPDB HeaderMoleculeTitle
c6by9A_2.30PDB header: transferaseChain: A: PDB Molecule: histone-lysine n-methyltransferase ehmt1;


Added to library: Sat Feb 3 08:59:12 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLVQAGANID
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)


SS


T
TT

TT

BTTTTTB
T
T

TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TCSEDQRTPLMEAAENNHLEAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYEVVQYLLSNGQMDVNCQD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)


TT


TT
T

S



TTS

TT
SS


TT


 .........150.........160.........170.........180.........190.........200.........210
Sequence DGGWTPMIWATEYKHVDLVKLLLSKGSDINIRDNEENICLHWAAFSGCVDIAEILLAAKCDLHAVNIHGD
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT


TT
TT

TT


TTS

T
TT

TT


TT

 .........220.........230.........240.........250.........260........
Sequence SPLHIAARENRYDCVVLFLSRDSDVTLKNKEGETPLQCASLNSQVWSALQMSKALQDS
Predicted secondary structure























SS confidence

























































Known secondary structure (DSSP)
TT
TT

SS


SSS

S
TTST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D