Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bwtD_

Fold library idPDB HeaderMoleculeTitle
c6bwtD_2.45PDB header: oxidoreductaseChain: D: PDB Molecule: thioredoxin reductase;


Added to library: Sat Dec 30 08:53:18 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NHHKLIILGSGPAGYTAAIYAARANLKPVIITGMQDTQIVYDTINAVDLQNKPFKLVGEVEQYTCDTLII
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)


STT












SSSS
SS
 .........80.........90.........100.........110.........120.........130.........140
Sequence ATGATAKYLGLESEEKFMGKGVSACATCDGFFYKNKDVAVVGGGNTAVEEALFLSNIAKSVTLIHRRDTL
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)







TBTTTS
GGGGTTS

BTTSS
SSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence RSEKILIDKLMEKAQHGNINIIWNTTLEEVLGDDMGVNALRIKNIKTNEESQMGVAGVFIAIGHTPNTSI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) BS
SS
STTTTT


S
S
S
GG
 .........220.........230.........240.........250.........260.........270.....
Sequence FAGQLEMENGYIKVKSGLAGDATQTNIKGVFAAGDVADHVYKQAVTSAGTGCMAALDAEKYLDNL
Predicted secondary structure





























SS confidence
































































Known secondary structure (DSSP) GTTTS
TT



SSSS
TTB
SSTT
GGGG
SS


T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D