Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bwlA_

Fold library idPDB HeaderMoleculeTitle
c6bwlA_1.45PDB header: lyaseChain: A: PDB Molecule: pal;


Added to library: Sat Jan 20 11:34:54 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKILVTGGAGFIGRWVVKRLLQDKHEVWILDNLANSTTANITEFAHDLNLKQCIQGDIKDKKLVAQLFEN
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TTTSTT



SS

GGGTGGGTT
TT


TT
T
 .........80.........90.........100.........110.........120.........130.........140
Sequence NSFDLCYHLAASINVQDSIDDARATFENDTIGTFNLLEQCLNYDVKMVFMSTCMVYDKATNIQGISELDP
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) S

S






TT


GGGB



STT
B
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence IKPASPYAGSKIAAENMVLSYYYAYKLPVVVIRPFNTYGPFQKTGGEGGVVAIFINNKLDNVPLNIYGDG
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) B


S





TT


STTS
TT

TTS
 .........220.........230.........240.........250.........260.........270.........280
Sequence KQTRDLLYVEDCADFVVAAGYSAKANGHIINAGTGQDISINKLAELISGNKVSIQHVTHIHPQSEIQKLL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)




GGGTT


S

TTSS


S
GGG

S


 .........290.........300.........310...
Sequence CNYEKAKTILNWEPKVSLEDGVIKTEEWIKSLK
Predicted secondary structure









SS confidence
































Known secondary structure (DSSP) B








T


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D