Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bwcA_

Fold library idPDB HeaderMoleculeTitle
c6bwcA_2.70PDB header: biosynthetic proteinChain: A: PDB Molecule: polysaccharide biosynthesis protein capd;


Added to library: Sat Jan 20 12:21:23 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MFFKDKNVLIIGGTGTIGKSILSNVLQEKPKVVRVFSRSEYNQFLLQEEFRDKNIRYLIGDIRNYDRVFS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
TTTT
TTTST

SS
TS




TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence AMENIDYVFHVAAMKHVSFCEYNPFEAVLTNIFGTQNVIKAAIAQKVKKVVFTSSNAAISPTNNYGATKL
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TTT
S





STTT
SGGGSS
SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TAERLITSAEYSKGSSETTFTSVRFGNVMGSRGSVIPLFENQIKENQKITVTDLSMSRFMMTLNQATMLT
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP) TTT



TT
TT
SS
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence IEAMKIAKGGETFILKMPVISLNDLSEVMIEEVTKENIKIEEIGLKPGEKMYEELMTHDESLQAFELPDM
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP)

SS











TT

SS
BSS
TT

SS
 .........290.........300.........310.........320....
Sequence FIIPSPLGTQYENAKRAKAGFYRSDQNAISKEELRNLILNQQLL
Predicted secondary structure


















SS confidence











































Known secondary structure (DSSP)







TT


SS

B






TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D