Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6buaA_

Fold library idPDB HeaderMoleculeTitle
c6buaA_7.10PDB header: rna binding proteinChain: A: PDB Molecule: dicer-2, isoform a;


Added to library: Sat Dec 30 08:51:16 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFRALFMCNTVELARQQAMAVRRCTNFKVGF
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
TS


TTS



SSTT

 .........80.........90.........100.........110.........120.........130.........140
Sequence YVGEQGVDDWTRGMWSDEIKKNQVLVGTAQVFLDMVTQTYVALSSLSVVIIDECHHGTGHHPFREFMRLF
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSS



SSS


STTTS



TTS
SSTTT

TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence TIANQTKLPRVVGLTGVLIKGNEITNVATKLKELEITYRGNIITVSDTKEMENVMLYATKPTEVMVSFPH
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) T
SSS

S




STTTT

S


STTS











 .........220.........230.........240.........250.........260.........270.........280
Sequence QEQVLTVTRLISAEIEKFYVSLDLMNIGVQPIRRSKSLQCLRDPSKKSFVKQLFNDFLYQMKEYGIYAAS
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP)
SSSTTTS


S
SSS

TTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence IAIISLIVEFDIKRRQAETLSVKLMHRTALTLCEKIRHLLVQKLQDMTYDDDDDNTPKVQRFLMSLKVSF
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) S
SS


STT


 .........360.........370.........380.........390.........400.........410.........420
Sequence ADKDPKDICCLVFVERRYTCKCIYGLLLNYNLMICSSACNHVFILDPVKTFNMYVQSKGRARTTEAKFVL
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSS
SS


SS






SS
S

S

S




SSSS


 .........430.........440.........450.........460.........470.........480.........490
Sequence FTADKEREKTIQQIYQYRKAHNDIAEYLKDRVLEKTEPELYEIKGHDALPRVGEICYAYEIFLEPQFESC
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
S
TS






SS
S
B




 .........500.........510.........520.........530.........540.........550.........560
Sequence EYTEHMYLNLQTPRNYAILLRNKLPRLAEMPLFSNQGKLHVRVANAPLEVIIQNSEQLELLHQFHGMVFR
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) SS





GGGSS
SS











SS


S

SB


TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence DILKIWHPFFVLDRRSKENSYLVVPLILGAGEQKCFDWELMTNFRRLPQSHGSNVQQREQQPAPRPEDFE
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) T

S
TTSS
SS


S






B
STT
B


SS
GGGS





SS





TTTTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence GKIVTQWYANYDKPMLVTKVHRELTPLSYMEKNQQDKTYYEFTMSKYGNRIGDVVHKDKFMIEVRDLTEQ
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) SB

SSS

SS
SS

TTS

SSSSSTT
STTTT


SSTTT








 .........710.........720.........730.........740.........750.........760.........770
Sequence LTFYVHNVILIPELCFNFNFPGDLWLKLIFLPSILNRMYFLLMERLEILGASFLKLSATLYLASKYSDWN
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) S

SS



TTTS


SSBTTTTTTTTTTTTTS



TTTTT
SSS
 .........780.........790.........800.........810.........820.........830.........840
Sequence EGTLTEVKSKLVVIADTLEALLGVIVKNYGLQHAFKMLEYFKICRADIDKPLTQLLNLELGGKKMRANVN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

TSSS
T


TTTTTTTS




SSS
 .........850.........860.........870.........880.........890.........900.........910
Sequence TTEIDGFLIDRRYLLQALTHPSYPTNRITGSYQELEFIGAAILDFLISAYIFENNTKMNPGALTDLRSAL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TTT
GGG

TTS

SSSSS
SS
S
SGGGS
TTTTTSS
SS
 .........920.........930.........940..
Sequence VNNTTLACICVRHRLNAKLSEIISKFVNFQES
Predicted secondary structure



SS confidence































Known secondary structure (DSSP)

TT


TTTTTTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D