Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bu9A_

Fold library idPDB HeaderMoleculeTitle
c6bu9A_6.80PDB header: rna binding protein/rnaChain: A: PDB Molecule: dicer-2, isoform a;


Added to library: Sat Dec 30 10:15:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEDVEIKPRGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SSS


TTTTSSS




TTS
TTTTTT
SSS





B
S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RQQAMAVRRCTNFKVGFYVGWTRGMWSDEIKKNQVLVGTAQALSSLSVVIIDECHHGPRVVGLTGTNVAT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTTTTSSS
B





TTTTS
TTT

S
B

BS


TTS
STTGGG



 .........150.........160.........170.........180.........190.........200.........210
Sequence KLKELEITYRGNIITVSDTKEMENVMLYATKPTEVMVSFPHQEQVLTVTRLISAEIEKFYVSLIYAASIA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT

S
B


S

S









S
SS

TTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence IISLIVEFDIKRRQAETLSVKLMHRTALTLCEKIRHLLVQKLQDMTYDDDDDNVNTEEVIMCCLVFVERR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SSS


SS




S
 .........290.........300.........310.........320.........330.........340.........350
Sequence YTCKCIYGLLLNYIKWQKSAIQQFRDGNANLMICSSVLEEGIDVQACNHVFILDPFNMYVQSKGRARTTE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTTTS

S


SGGGSS


SS


S


TSS

S
 .........360.........370.........380.........390.........
Sequence AKFVLFTKEREKTIQQIYQYRKAHNDIAEYLKDRVLEKTEPELYEIKGH
Predicted secondary structure










SS confidence
















































Known secondary structure (DSSP)








STS
TT

STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D