Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bu9A_

Fold library idPDB HeaderMoleculeTitle
c6bu9A_6.80PDB header: rna binding protein/rnaChain: A: PDB Molecule: dicer-2, isoform a;


Added to library: Sat Dec 30 10:15:29 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MEDVEIKPRGYQLRLVDHLTKSNGIVYLPTGSGKTFVAILVLKRFSQDFDKPIESGGKRALFMCNTVELA
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


SSS


TTTTSSS




TTS
TTTTTT
SSS





B
S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence RQQAMAVRRCTNFKVGFYVGWTRGMWSDEIKKNQVLVGTAQALSSLSVVIIDECHHGPRVVGLTGTNVAT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTTTTTTSSS
B





TTTTS
TTT

S
B

BS


TTS
STTGGG



 .........150.........160.........170.........180.........190.........200.........210
Sequence KLKELEITYRGNIITVSDTKEMENVMLYATKPTEVMVSFPHQEQVLTVTRLISAEIEKFYVSLIYAASIA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TT

S
B


S

S









S
SS

TTTT

 .........220.........230.........240.........250.........260.........270.........280
Sequence IISLIVEFDIKRRQAETLSVKLMHRTALTLCEKIRHLLVQKLQDMTYDDDDDNVNTEEVIMCCLVFVERR
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)
SSS


SS




S
 .........290.........300.........310.........320.........330.........340.........350
Sequence YTCKCIYGLLLNYIKWQKSAIQQFRDGNANLMICSSVLEEGIDVQACNHVFILDPFNMYVQSKGRARTTE
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)


TTTTS

S


SGGGSS


SS


S


TSS

S
 .........360.........370.........380.........390.........
Sequence AKFVLFTKEREKTIQQIYQYRKAHNDIAEYLKDRVLEKTEPELYEIKGH
Predicted secondary structure










SS confidence
















































Known secondary structure (DSSP)








STS
TT

STT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D