Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bt2B_

Fold library idPDB HeaderMoleculeTitle
c6bt2B_2.41PDB header: hydrolase, rna binding proteinChain: B: PDB Molecule: nocturnin;


Added to library: Sat May 19 08:48:12 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence STRPPRFQRDFVDLRHPPIRVMQWNILAQALGELKWEERKCLILEEILAYQPDILCLQEVDHYFDTFQPL
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)

S















SS
S
TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LSRLGYQGTFFPKPWSPCLDVEHNNGPDGCALFFLQNRFKLVNSANIRLTAMTLKTNQVAIAQTLECKES
Predicted secondary structure





































SS confidence





































































Known secondary structure (DSSP) TT
TT
GGGGSTT

S

TTTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence GRQFCIAVTHLKARTGWERFRSAQGCDLLQNLQNITQGAKIPLIVCGDFNAEPTEEVYKHFASSSLNLNS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)




STT
TTTTTS




TTSSTT
 .........220.........230.........240.........250.........260.........270.
Sequence AYKLLSADGQSEPPYTTWRHTLDYIWYSKHALNVRSALDLLLPSFNYPSDHLSLVCDFSFT
Predicted secondary structure







































SS confidence




























































Known secondary structure (DSSP) GGGGGSSSS



S
SB




TTT








SSSB



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D