Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bs7A_

Fold library idPDB HeaderMoleculeTitle
c6bs7A_1.95PDB header: ligaseChain: A: PDB Molecule: adenylosuccinate synthetase;


Added to library: Sat Jan 20 10:50:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGKNVVVLGTQWGDEGKGKIVDLLTQDAQVVVRYQGGHNAGHTTVLRLIPSGMLRPNVTCYIANGVVLSP
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)


SSSS
S
TTT
S
S

SS






SSS
GGGGSTT

TT

B
 .........80.........90.........100.........110.........120.........130.........140
Sequence QALLSEIKELEGNGINVRERLRISLACPLILPYHIALDKARERGIGPAYEDKVARRALRVGDLFHRDRFA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT

TT
BB




TT


BGGGGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence NKLTELLDYHNFVLTQYFKQPAVDLESLLGESLQWAEELRPMVCDVSACLHEHRKQGENILFEGAGSVIN
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT





TTGGG
TT





 .........220.........230.........240.........250.........260.........270.........280
Sequence GAGFGPRYIDYVLGITKAYTTRVGGGPFPTELLDDVGKRIAERGQEFGAVTGRPRRCGWFDAVLLKRSIE
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) T

GGG

SS
SSS

TTB

STT
B
TTT

B

 .........290.........300.........310.........320.........330.........340.........350
Sequence LNSISGLCVTKLDVLDGLEVLRIAVAYKDRDGNILSRPPLAADDFNDLLPVYEELPGWQESTADVTVMSD
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) T


GGGGTT
S
TT

SS

SSGGGGTT



S

TT

SGGG
 .........360.........370.........380.........390
Sequence LPANARAYLKRIEEILGIPIDMLSTGPERDSTITLRGPFL
Predicted secondary structure












SS confidence







































Known secondary structure (DSSP) S
SS

SSSTTSSS
TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D