Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6brhA_

Fold library idPDB HeaderMoleculeTitle
c6brhA_3.40PDB header: hydrolaseChain: A: PDB Molecule: deoxynucleoside triphosphate triphosphohydrolase samhd1;


Added to library: Sat Feb 17 08:25:39 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TDLRTWEPEDVCSFLENRGFREKKVLDIFRDNKIAGSFLPFLDEDRLEDLGVSSLEERKKMIECIQQLSQ
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

STT

TT


TT

GGGGGG

T


TTSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence SRIDLMKVFNDPIHGHIEFHPLLIRIIDTPQFQRLRYIKQLGGGYYVFPGASHNRFEHSLGVGYLAGCLV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)
STTS
TTT
SSGGGGSBTTGGGGGT
TT


B
 .........150.........160.........170.........180.........190.........200.........210
Sequence RALAEKQPELQISERDILCVQIAGLCHDLGHGPFSHMFDGRFIPRARPEKKWKHEQGSIEMFEHLVNSNE
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
GGG


TTTTT
BTTBT
TTS


TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LKLVMKNYGLVPEEDITFIKEQIMGPLWPYKGRPATKSFLYEIVSNKRNGIDVDKWDYFARDCHHLGIQN
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) TT







SSS
GGGGGGGGTS

TTTT
ST


 .........290.........300.........310.........320.........330.........340.........350
Sequence NFDYKRFIKFARICEVEYKVYIRKVKHICSREKEVGNLYDMFHTRNCLHRRAYQHKISNLIDIMITDAFL
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)


T


GGGTTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence KADPYVEITGTAGKKFRISTAIDDMEAFTKLTDNIFLEVLHSTDPQLSEAQSILRNIECRNLYKYLGETQ
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TTT


GGG

TTTGGG
TT
STT


GGGTT



 .........430.........440.........450.........460.........470.........480.........490
Sequence PKREKIRKEEYERLPQEVAKAKPVELKAEDFIVDVINVDRVHFYEQLIRVYCKKKDGKSLDAAGKHFVQW
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) BSSS


TTGGGG






GGG





S

S
 .........500
Sequence CALRDFTKPQ
Predicted secondary structure






SS confidence









Known secondary structure (DSSP) TTB




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D