Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bqwH_

Fold library idPDB HeaderMoleculeTitle
c6bqwH_4.20PDB header: cytosolic proteinChain: H: PDB Molecule: uncharacterized protein;


Added to library: Sat Mar 3 08:36:15 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MTLTTVIDIGNFSTKYAYKDKKQIKVGSFPSILHSYKPLEDYEGMERVEYNGLDYYVGETVKNFYFGREE
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP)




SS
TTTS





S


S

SSTTSTTTTT
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence QMYFGNTRKGHMEGQIRLVYALYTIFKETGKKEFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFK
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT




SS

ST


B
GGGS
TTB

 .........150.........160.........170.........180.........190.........200.........210
Sequence FTVHNIVMAAEGLGALNFSDSLNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAK
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S

TTGGGGGTSTT
SSTTTT
TTT
S

TTTS
 .........220.........230.........240.........250.........260.........270.....
Sequence TCSNIDYDYPIVCTGGKAEEMKECLENVGYSTVSSAELGEDKPSYYVNSVGLLLKYGRKFEEMFA
Predicted secondary structure




















SS confidence
































































Known secondary structure (DSSP) TTTS
TTS
SSST
SS


SSS

GGGT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D