Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bqhA_

Fold library idPDB HeaderMoleculeTitle
c6bqhA_2.70PDB header: membrane proteinChain: A: PDB Molecule: 5-hydroxytryptamine receptor 2c,soluble cytochrome b562;


Added to library: Sat Feb 17 09:11:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence FKFPDGVQNWPALSIVIIIIMTIGGNILVIMAVSMEKKLHNATNYFLMSLAIADMLVGLLVMPLSLLAIL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)


STT


SGGGGG
GGG
ST
 .........80.........90.........100.........110.........120.........130.........140
Sequence YDYVWPLPRYLCPVWISLDVLFSTASIMHLCAISLDRYVAIRNPIEHSRFNSRTKAIMKIAIVWAISIGV
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) TTT


S
TTTTSS




SS
 .........150.........160.........170.........180.........190.........200.........210
Sequence SVPIPVIGLRDEEKVFVNNTTCVLNDPNFVLIGSFVAFFIPLTIMVITYCLTIYVLRRQAADLEDNWETL
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TSGGGSTTT



T
 .........220.........230.........240.........250.........260.........270.........280
Sequence NDNLKVIEKAVKDALTKMRAAALDAQKATMKDFRHGFDILQLKTTRNAYIQKYLQAINNERKASKVLGIV
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP) TT


TT


T

T
 .........290.........300.........310.........320.........330.........340.........350
Sequence FFVFLIMWCPFFITNILSVLCEKSCNQKLMEKLLNVFVWIGYVNSGINPLVYTLFNKIYRRAFSNYLRCN
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S
SSSS

T
 .
Sequence Y
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D