Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bq6B_

Fold library idPDB HeaderMoleculeTitle
c6bq6B_1.65PDB header: transferaseChain: B: PDB Molecule: thermospermine synthase;


Added to library: Sat Mar 3 08:33:48 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KSCWYEEEIEENLRWCFALNSILHTGASQYQDIALLDTKPFGKALVLDGKLQSAETDEFIYHECLVHPAL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)


TT
SS
TTTTTTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence LHHPMPKNVFIMGGGEGSTARELLRHKTIDKVVMCDIDEEVVEFCKSYLVVNKEAFHDSRLEVVINDAKA
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) SSS



SSTBTT

S

GGG
TTS
 .........150.........160.........170.........180.........190.........200.........210
Sequence ELEGKEEKYDVIVGDLADPIEGGPCYKLYTKDFYELTLKPKLKKGGIFVTQAGPAGIFSHTEVFSCIYNT
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T








TTSTTGGGGSTTGGG
STTGGGTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence LRQVFKYVVPYSAHIPSYADIWGWVLASDSPLDLSAEELDIRMRQRIIEENRYLDGKTFVSSSTLSKAVR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
SGGGTSS




BSS

SS

TS

 .........290..
Sequence NSLNNETHVYTE
Predicted secondary structure







SS confidence











Known secondary structure (DSSP)







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D