Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bq1A_

Fold library idPDB HeaderMoleculeTitle
c6bq1A_3.60PDB header: transferase/signaling proteinChain: A: PDB Molecule: phosphatidylinositol 4-kinase iii alpha (pi4ka);


Added to library: Sat Dec 16 08:39:30 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT

TT


TT

TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT

TT

TT


TT

 .........150.........160.........170.........180.........190.........200.........210
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT

TTT

TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP)
TT

T

TT

TT

 .........290.........300.........310.........320.........330.........340.........350
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT

TT

TT

TT


 .........360.........370.........380.........390.........400.........410.........420
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure





































































SS confidence





































































Known secondary structure (DSSP) TT


TT


TT

T

TT
 .........430.........440.........450.........460.........470.........480.........490
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXMMQCVIAVADKVFD
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP)


TT

TS

S

STTT

 .........500.........510.........520.........530.........540.........550.........560
Sequence AFLNMMADKAKTKENEEELERHAQFLLVNFNHIHKRIRRVADKYLSGLVDKFPHLLWSGTVLKTMLDILQ
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TT
S
T
S

GGGSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence TLSLSLSADIHKDQPYYDIPDAPYRITVPDTYEARESIVKDFAARCGMILQEAMKWAPTVTKSHLQEYLN
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) S
STTS
S
SSSS


SSS
TT
 .........640.........650.........660.........670.........680.........690.........700
Sequence KHQNWVSGLSQHTGLAMATESILHFAGYNKQNTTLGATQLSERPACVKKDYSNFMASLNLRNRYAGEVYG
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTTS

S



TTTSS
SSSS

S

STTT

 .........710.........720.........730.........740.........750.........760.........770
Sequence MIRFDLNKMMVQDLHSALDRSHPQHYTQAMFKLTAMLISSKDCDPQLLHHLCWGPLRMFNEHGMETALAC
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) T


T
SSSS

TSTTTS
S
 .........780.........790.........800.........810.........820.........830.........840
Sequence WEWLLAGKDGVEVPFMREMAGAWHMTVEQKFGLFSAEIKEADPLAASEASQPKPCPPEVTPHYIWIDFLV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) STT
TT
GGG







TTS

SSS








 .........850.........860.........870.........880.........890.........900.........910
Sequence QRFEIAKYCSSDQVEIFSSLLQRSMSLNIGGAKGSMNRHVAAIGPRFKLLTLGLSLLHADVVPNATIRNV
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
SS



SSS

SS


GGGTT
S
S
 .........920.........930.........940.........950.........960.........970.........980
Sequence LREKIYSTAFDYFSCPPKFPTQGEKRLREDISIMIKFWTAMFSDKKRGSQLHKYYMKRRTLLLSLLATEI
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TTS











 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence ERLITWYNPLSAPELELDQAGENSVANWRSKYISLSEKQWKDNVNLAWSISPYLAVQLPARFKNTEAIGN
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)

SSTTTSS


TTSS
STTT
TTTS

SSS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence EVTRLVRLDPGAVSDVPEAIKFLVTWHTIDADAPELSHVLCWAPTDPPTGLSYFSSMYPPHPLTAQYGVK
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
GGG


TTTS
SSTTT



TT

GGGS



TGGGSSSS


 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence VLRSFPPDAILFYIPQIVQALRYDKMGYVREYILWAASKSQLLAHQFIWNMKTNIYLDEEGHQKDPDIGD
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) S
TGGGTT
SSS
BSSTTTSSB
TTT
 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence LLDQLVEEITGSLSGPAKDFYQREFDFFNKITNVSAIIKPYPKGDERKKACLSALSEVKVQPGCYLPSNP
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)

TS

S
GGGT
SS

SB
SS
T
 .........1270.........1280.........1290.........1300.........1310.........1320.........1330
Sequence EAIVLDIDYPMQSAAKAPYLAKFWQAAIFKVGDDCRQDMLALQIIDLFKNIFQLVGLDLFVFPYRVVATA
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) T
B








SSSS





SS
S











S
 .........1340.........1350.........1360.........1370.........1380.........1390.........1400
Sequence PGCGVIECIPDCTSRDQLGMYDYFTRQYGDESTLAFQQARYNFIRSMAAYSLLLFLLQIKDRHNGNIMLD
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT

SS


SS



SSSST

S


SSS
B
 .........1410.........1420.........1430.........1440.........1450.........1460.........1470
Sequence KKGHIIHIDFGFMFESDIKLTDEMVMIMGGKMEATPFKWFMEMCVRGYLAVRPYMDAVVSLVTLMLDTGL
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GGG
B



GGGSS



S

TTT
SSS
TT
TTSSSS
 .........1480.........1490.........1500.........
Sequence PCFRGQTIKLLKHRFSPNMTEREAANFIMKVIQSCFLSN
Predicted secondary structure











SS confidence






































Known secondary structure (DSSP) S


S

TTS



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D