Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bpzC_

Fold library idPDB HeaderMoleculeTitle
c6bpzC_3.80PDB header: membrane proteinChain: C: PDB Molecule: piezo-type mechanosensitive ion channel component 1,piezo-


Added to library: Sat Dec 30 08:35:01 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PNPIPNFIHCRSYLDMLKVAVFRYLFWLVLVVVFVAGATRISIFGLGYLLACFYLLLFGTTLLQKDTRAQ
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)


S


SSSS
SSSSTTSS

TTTTS
 .........80.........90.........100.........110.........120.........130.........140
Sequence LVLWDCLILYNVTVIISKNMLSLLSCIIWDSICFFFLLLQRRIFLSHYFLHVSADLKATALQASRGFALY
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP)

T
TTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence NAANLKSINFHRQIEEKSLAQLKRQMKRIRAKQEKYRQSQAHATVIHSGDYFLFESXXXXXXXXXXXXXX
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTTTT


GGG





S
 .........220.........230.........240.........250.........260.........270.........280
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPELEEAERFEAQQGRTLRLLRAGYQ
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP)


ST

TTTTTT
TTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence CVAAHSELLCYFIIILNHMVTASAASLVLPVLVFLWAMLTIPRPSKRFWMTAIVFTEVMVVTKYLFYIKY
Predicted secondary structure








SS confidence





































































Known secondary structure (DSSP)



TTTSTTTSSS




 .........360.........370.........380.........390.........400.........410.........420
Sequence DLVQLMALFFHRSQLLCYGLWDPLQRFFHDILHTKYRAATDVYALMFLADIVDIIIIIFGFPQAFLFMLL
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP) TT



GGGTS

S







 .........430.........440.........450.........460.........470.........480.........490
Sequence VQFGTMVIDRALYLRKTVLGKLAFQVVLVVAIHIWMFFIQNAVAQLWYFVKCIYFALSAYQIRCGYPTRI
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TT
ST




S

 .........500.........510.........520.........530.........540.........550.........560
Sequence LGNFLTKKYNHLNLFLFQGFRLVPFLVELRAVMDWVWTDTTLSLSNWMCVEDIYANIFIIKCSRETEKKY
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)
S
TT
SS
STSSSTTTS


S
S
 .........570.........580.........590.........600.........610.........620.........630
Sequence PQPKGQKKKKIVKYGMGGLIILFLIAIIWFPLLFMSGVVNQPIDVTVTLKLGGYEPLFTMSAQQPSIVPF
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)


SS









TTS

S
TTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence TPQAYEELSQQFDPYPLAMQFISQYSPEDIVTAQIEGSSGALWRISPPSRAQMKQELYNGTADITLRFTW
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP)
TTT
TT

GGGSB
SS






S
 .........710.........720.........730.........740.........750.........760.........770
Sequence NFQRDLAKGGTVEYTNEKHTLELAPNSTARRQLAQLLEGRPDQSVVIPHLFPKYIRAPNGPEANPVKQLQ
Predicted secondary structure













































SS confidence





































































Known secondary structure (DSSP)
GGGS
S


TT
GGG

TT




SSSB

B
TTT
 .........780.........790.........800.........810.........820.........830.........840
Sequence PDEEEDYLGVRIQLRREQVSDFLEWWVIELQDCKADCNLLPMVIFSDKVSPIVGLYVSIVLVVGKFVRGF
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TTTTTTS


TT

S
TT





 .........850.........860.........870.........880.........890.........900
Sequence FSEISHSIMFEELPCVDRILKLCQDIFLVRETRELELEEELYAKLIFLYRSPETMIKWTR
Predicted secondary structure














SS confidence



























































Known secondary structure (DSSP) TSSTTTTSTTT

S

TT

SSTT



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D