Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bpqD_

Fold library idPDB HeaderMoleculeTitle
c6bpqD_4.10PDB header: transport proteinChain: D: PDB Molecule: transient receptor potential cation channel subfamily m


Added to library: Sat Dec 16 08:33:00 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXXXXXXXCDTDSETLYDLMTQHWHLKTPNLVISVTKNFALKPRMRKIFSRLIYIAQS
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)










S

SSS


S







 .........80.........90.........100.........110.........120.........130.........140
Sequence KGAWIFTGLMKYIGEVVRDNTISRSSEENVVAIGIAXXXXXLKRDPLYCLDNNHTHLLLVEAKVRTQLEK
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) T


S
S

-











TTT
S


 .........150.........160.........170.........180.........190.........200.........210
Sequence YISERVIPESNYGGKIPIVCFAQGGGKETLKSINVAIKSKIPCVVVEGSIADVIASLVSSCVKESLLRFL
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)


S
GGG
SS


TT
TT





T


 .........220.........230.........240.........250.........260.........270.........280
Sequence PRTISRLSEEETESWIKWIKEVLESPHLLTVIKIEIVSNAISFALYKAFSTNEHDRDNWNGQLKLLLEWN
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) S
TT
TTT



SSSS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence QLDLASDEIFTNDRNWESADLQDVMFTALVKDRPKFVRLFLENGLNLRKFLTTEVLRELYTNNFSSLVFK
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTS



TTTTTT





TSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence NLQIAKNSYNDALLTFVWKMVEDFRRGRHPLQALFIWSVLQNKKELSKVIWEQTRGCTLAALGASKLLKS
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)






TT
TTT
SS
 .........430.........440.........450.........460.........470.........480.........490
Sequence MAKVKNDINAAGESEELANEYETRAVELFTECYSNDEDLAEQLLTYSCEAWGGSNCLELAVEARDQQFIA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) S

S

S


SSSSS

STT
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence QPGVQNFLSKQWYGEISRDTKNWKIILCLFFFPLIGCGFISFRKKKLFLYYVSFFTSPFVVFSWNVIFYI
Predicted secondary structure















SS confidence





































































Known secondary structure (DSSP) STTB
SSS
S

B


TT
 .........570.........580.........590.........600.........610.........620.........630
Sequence AFLLLFAYVLLMDFQKEPTALEIILYVLVFILLCDEVRQWYMNGSKYFSDLWNVMDTLAIFYFIAGIVFR
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) T

SSS


SSSTTTSTT
 .........640.........650.........660.........670.........680.........690.........700
Sequence LHSSSWYSGRVIFCLDYIVFTLRLIHIFTVSRNLGPKIIMLQRMMIDVFFFLFLFAVWMVAFGVARQGIL
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) TT



ST
 .........710.........720.........730.........740.........750.........760.........770
Sequence RWEWIFRSVIYEPYLAMNNQPRFPEWITIPLVCIYMLSTNILLVNLLVADQVWKFQRFFLVQEYCSRLTX
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP)




SS
GGGTTTT

T
S
 .........780.........790.........800.........810.........820.........830.....
Sequence XXXXXXXXXXXXXXXXXRNEDNEILAWEAVMKENYLVKINTXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure






















SS confidence
































































Known secondary structure (DSSP) SSGGGTT







Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D