Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bngB_

Fold library idPDB HeaderMoleculeTitle
c6bngB_2.20PDB header: transferaseChain: B: PDB Molecule: 2-dehydro-3-deoxyphosphooctonate aldolase;


Added to library: Sat Dec 23 08:28:24 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KPQEVVRLGDIQMANHLPFVLFGGMNVLESKDLAFEIAETYIDICKRLDIPYVFKASFDKANRSSLHSFR
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)


SSTT
TTS




T

S

TT
SSTTS

 .........80.........90.........100.........110.........120.........130.........140
Sequence GPGLEKGIEWLGDIKKHFNVPIITDVHEPYQAAPVAEVADIIQLPAFLSRQTDLVEAMAKTQAIINIKKA
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
ST



SGGG
S
GGGTT
T
S

 .........150.........160.........170.........180.........190.........200.........210
Sequence QFLAPHEMRHILHKCLEAGNDKLILCERGSAFGYNNLVVDMLGFDIMKEMNVPVFFDVTHALQTPRRAQI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TT

GGGTT





SSS


TTTTTS
S



GGG
 .........220.........230.........240.........250.........260.........270
Sequence TTLARAGMATGLAGLFLESHPDPDKCDGPSALRLSQLEPFLAQLKELDTLVKGFKKLDTH
Predicted secondary structure
























SS confidence



























































Known secondary structure (DSSP) T

SSS



SGGG
GGGTS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D