Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bneA_

Fold library idPDB HeaderMoleculeTitle
c6bneA_2.61PDB header: transferaseChain: A: PDB Molecule: phosphoethanolamine transferase;


Added to library: Sat Feb 3 08:26:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PTETIMHANDAIQKTTASTRKPRLVVMVVGETARADHASFNGYQRATFPHMDKLIGLGQVHNFGNVTSCG
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

S
B
S
TT
SS
TTTS


S

GGG
GGGT
SS
S
TTS

S
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence TSTAYSVPCMFSYLGAEKYDVDTADYHENVIDTLDRLGVAILWRDNNSDSKGVMNRLPAKQYQDYKNSPL
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) SSS
SS
TTT

GGGTTTB

T
SSS

TTTTTTS
GGG
SS
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence QGGNNTICHTNPYDECRDVGMLVDLDDHVKAHANQDILIVLHQMGNHGPAYYKRYDDEFAQFLPVCTSSE
Predicted secondary structure
















































SS confidence





































































Known secondary structure (DSSP) TT


S

SSSTT



GGGGGTT
TTTS


TT
SS
GGGSS
GGG

S
S


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LAECERQTVINAYDNALLATDDFLKQTIDWLAAQTHADTAMLYLSDHGESLGEKGVYLHGMPKAFAPKEQ
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTTS
T

SSS


TTS


TTT

TTT
 .........290.........300.........310.........320.........330......
Sequence LSIPALLWLGADTPFAVANSPTAGFSHDAITPTLLNLFDVSTQATADKTAFVNPLD
Predicted secondary structure































SS confidence























































Known secondary structure (DSSP) T

TT
S

B



SS

BGGGTT
GGGSS


SB




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D