Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bn2A_

Fold library idPDB HeaderMoleculeTitle
c6bn2A_1.65PDB header: transferaseChain: A: PDB Molecule: acetyl-coa acetyltransferase;


Added to library: Sat Jan 20 09:09:38 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MKEVFIVSAVRTPMGSFMGSLSGVPATQLGAVAIKGALDKINLNPAEIQDVYMGNVLQAGEGQAPAKQAA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)





TTSTTTTS
TT

GGG



S

TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence LGAGLPNTTPTTAVNKVASGMKAVMMAAQAVKAGDVEAIVAGGMENMSQVPHYIDGRNGVKLGDIKLQDG
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT

TT





TTS
SGGG




SS

SSS



 .........150.........160.........170.........180.........190.........200.........210
Sequence LLKDGLTDVYSKQHMGNAELCAKEYNITREEQDAFAIQSYERSAKAWSEGKFKEEVVPVSIPQRKGEPII
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) TTB
TTT

BTT

TT

TTTTTTTB



SSSS
 .........220.........230.........240.........250.........260.........270.........280
Sequence FAEDEEYKNVKFDRIPTLPTVFQKENGTVTAANASTLNDGASALVLMSKEKMESLGLKPLAKIVSYADAA
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP)
S

GGGS

GGGGGGS
BSS
SSS


BTTTB


TT


S
 .........290.........300.........310.........320.........330.........340.........350
Sequence QAPEWFTTAPAKALPIALAKANLTINDIDFFEFNEAFSVVGLANNKILGLDAAKVNVNGGAVALGHPLGS
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)

GGGGGGTT

GGG



SBT

GGGBSTT




 .........360.........370.........380.........390.
Sequence SGSRIIVTLINVLKQNNAKYGAAAICNGGGGASAIVIENIK
Predicted secondary structure












SS confidence








































Known secondary structure (DSSP) TT
STTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D