Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bmsA_

Fold library idPDB HeaderMoleculeTitle
c6bmsA_2.44PDB header: membrane proteinChain: A: PDB Molecule: palmitoyltransferase;


Added to library: Sat Jan 13 08:23:27 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RCCQRIFSWIPVIIISSVVLWSYYAYVFELCFVTNNLERVTYLLIFHVCFIMFCWTYWKAIFTPPSTPTK
Predicted secondary structure












SS confidence





































































Known secondary structure (DSSP)
TTT








G
 .........80.........90.........100.........110.........120.........130.........140
Sequence KFHLSYTDKERYRPEVQKQILVDIAKKLPIFTRAQSGAIRFCDRCQVIKPDRCHHCSVCETCVLKMDHHS
Predicted secondary structure
























































SS confidence





































































Known secondary structure (DSSP) GGB



TTT


TTS



B
TTS


TTTT

TT
TTTTTT

 .........150.........160.........170.........180.........190.........200.........210
Sequence PWVNNCVGFSNYKFFLLFLSYSMIYCVFIASTVFQYFLKFWVGDLAKFHVLFLLFVALMFFVSLMFLFGY
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP) TTTTSTTTTT



TT
 .........220.........230.........240.........250.........260.........270.........280
Sequence HCWLVAKNRSTLEAFSPPVFQNGPDRNGFNVGLSKNLRQVFGEHKKLWFIPVFTSQGDGHYFPLRTLRES
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) T

S

TT
TTTT



S
GGGTTS
S



S
SS



GGGTT
 .
Sequence E
Predicted secondary structure
SS confidence
Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D