Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bmnA_

Fold library idPDB HeaderMoleculeTitle
c6bmnA_2.25PDB header: transferaseChain: A: PDB Molecule: human dhhc20 palmitoyltransferase;


Added to library: Sat Jan 27 08:25:08 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLWRCCQRVVGWVPVLFITFVVVWSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMFVWSYWMTIF
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP)
TTT







TTTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence TSPASPSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTTSASKTIRYCEKCQLIKPDRAHHCSA
Predicted secondary structure































































SS confidence





































































Known secondary structure (DSSP) S





GGGB

TT


TTS



TTS


TTTT

TT
TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence CDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLYCLFVAATVLEYFIKFWTTDTRAKFHVLFLFFVS
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP) TTTT

GGGTSTTT


 .........220.........230.........240.........250.........260.........270.........280
Sequence AMFFISVLSLFSYHCWLVGKNRTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFGDEKKYWLLPIFSSLG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) T

S

TT
TTTT



S
GGGTTSSS



S
 .........
Sequence DGCSFPTRL
Predicted secondary structure


SS confidence








Known secondary structure (DSSP)
SS






Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D