Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bmeB_

Fold library idPDB HeaderMoleculeTitle
c6bmeB_1.90PDB header: heme binding proteinChain: B: PDB Molecule: truncated hemoglobin 4;


Added to library: Sat Dec 23 08:54:17 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TLHAKLGGAAAVAATVDVFYKKLMNDPDLEPFFRGVDMVTLIAKQNRFLAYAFGATTHYHGKDIVMGHAH
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)
TTST
TTTTT

TT

SS

 .........80.........90.........100.........110.........120.....
Sequence LIINRGLNLTHFDKVAGHFVDSLKEMGVGQELIDEAAGVLIGVRPLFDPERYKGK
Predicted secondary structure















SS confidence






















































Known secondary structure (DSSP) S


TT

GGGG
GGG
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D