Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bm8A_

Fold library idPDB HeaderMoleculeTitle
c6bm8A_4.10PDB header: viral proteinChain: A: PDB Molecule: envelope glycoprotein b;


Added to library: Sat May 19 08:25:40 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RDIKAENTDANFYVCPPPTGATVVQFEQPRRCPTRPEGQNYTEGIAVVFKENIAPYKFKATMYYKDVTVS
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP)




S
TTS





SS


















S
 .........80.........90.........100.........110.........120.........130.........140
Sequence QVWFGHRYSQFMGIFEDRAPVPFEEVIDKINAKGVCRSTAKYVRNNLETTAFHRDDHETDMELKPANAAT
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT






TSSTTGGGS







S
 .........150.........160.........170.........180.........190.........200.........210
Sequence RTSRGWHTTDLKYNPSRVEAFHRYGTTVNCIVEEVDARSVYPYDEFVLATGDFVYMSPFYGYREGSHTEH
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) SS

S
SS






TT


TT
S
TTS

B
TT
SSSSSGGGS
 .........220.........230.........240.........250.........260.........270.........280
Sequence TSYAADRFKQVDGFYARDLTTKARATAPTTRNLLTTPKFTVAWDWVPKRPSVCTMTKWQEVDEMLRSEYG
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) BSS
TTT


B
SSS

B
SS

SS



STTT

ST
 .........290.........300.........310.........320.........330.........340.........350
Sequence GSFRFSSDAISTTFTTNLTEYPLSRVDLGDCIGKDARDAMDRIFARRYNATHIKVGQPQYYLANGGFLIA
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP) TTTTTB


SS


GGGBSSTTTTT
SS
TTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence YQPLLSNTLAELYVREHLREQSRKPPNPTPPASVERIKTTSSIEFARLQFTYNHIQRHVNDMLGRVAIAW
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGGGGTTS

TTS




B




S

 .........430.........440.........450.........460.........470.........480.........490
Sequence CELQNHELTLWNEARKLNPNAIASVTVGRRVSARMLGDVMAVSTCVPVAADNVIVQNSMRISSRPGACYS
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP)
SS

SSS

GGG

SB
S
SSSTTS
 .........500.........510.........520.........530.........540.........550.........560
Sequence RPLVSFRYEDQGPLVEGQLGENNELRLTRDAIEPCTVGHRRYFTFGGGYVYFEEYAYSHQLSRADITTVS
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) S

SSSSS


GGGBSS




TT
TTSSB
STTS



 .........570.........580.........590.........600.........610.........620.........630
Sequence TFIDLNITMLEDHEFVPLEVYTRHEIKDSGLLDYTEVQRRNQLHDLRFADIDTVIHADANAAVMGIVGGV
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) S

















SS
TTSS

T
TTTTT


S





TTT

 .........640.........650.........660.....
Sequence VSAVSGVSSFMSNPFGALAVGLLVLAGLAAAFFAF
Predicted secondary structure


SS confidence


































Known secondary structure (DSSP) TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D