Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bljC_

Fold library idPDB HeaderMoleculeTitle
c6bljC_2.10PDB header: ligaseChain: C: PDB Molecule: serine-trna ligase;


Added to library: Sat Dec 23 08:40:40 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence HHHMLDINLFREYKGGNPEIIRESQRRRFADVTLVDKVIELDEVWRATIGKLNHIKSFTGIISKEQLKKL
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)





GGGG
GGGT

TT

T

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence STYITEVHIKNSEEEVKQKEKERDDVLLQIGNIVHETVVVSDNEDNNGIVRMVGNPRPKVDPETGYKCLK
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TTTS




TTS


S
GGG
S



SB
TTT

B


 .........150.........160.........170.........180.........190.........200.........210
Sequence HIDIMRKLGGLATEEGTQVGGGRGYFLLGDLVRMNLALQNYAIDFLAKKGYMPIYTPFFMTKEQMKKVAQ
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) TT

TT


TTT


SS
 .........220.........230.........240.........250.........260.........270.........280
Sequence LSQFDEELYTVTGEGEDKYLIATSEQPIAAFHLEKRFDESELPIKYCGMSTCFRKEVGAHGKDTLGIFRV
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) TT


SSSS

SSTTTT

GGG




GGGTTSS
STTSS
 .........290.........300.........310.........320.........330.........340.........350
Sequence HQFEKIEQFVVTSPKDNKSWEMFDEMIGNSEAFYQSLGIPYRVVNIVSGALNNAAAKKFDLEAWFPGADE
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) S
SSTTTT



GGG

SS
S
TTS
T
 .........360.........370.........380.........390.........400.........410.........420
Sequence GNEYRELVSCSNCTDYQTRRLEVKYGQGSEVEFCHMLNSTLTATSRTLCCIVENYQTPEGVNVPEVLQPY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T


TTT


TT


B
SS

GGGSGG
 .........430.
Sequence MGGTKFIKFKN
Predicted secondary structure







SS confidence










Known secondary structure (DSSP) GTT





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D