Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bldA_

Fold library idPDB HeaderMoleculeTitle
c6bldA_2.00PDB header: oxidoreductaseChain: A: PDB Molecule: cytochrome p450 268a2 cyp268a2;


Added to library: Sat Jan 27 10:57:11 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence ASVRPYDTIDLSSRAFWASSASQRESSFSELRAERPVSWHPPVEDALIQDPNDPGFWAVTRRADIVAVSR
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)






SS

SSS

S


TT
SS

TT



S
 .........80.........90.........100.........110.........120.........130.........140
Sequence TNEVFLSGNGVLFENVPAELLEASQSFLAMDPPRHTKLRKLVSAAFTPRQVRRIEDSIKINAKGIVDELR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
TTTSTT


SS


TT
GGGG

TTGGGGS
 .........150.........160.........170.........180.........190.........200.........210
Sequence MAGGGVDFVEHCAKELPIRTLSDMVGIPEADRERVAHAADALVSWADPRYLNGREPLAVLFENQMYLHQV
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
TTSBTTTT

GGGTT
TT
TT

 .........220.........230.........240.........250.........260.........270.........280
Sequence AASLAAERRDRPGDDLFSALVNAEVDGDRLADADVAAFFVLLAVAGNDTTRQTISHGLKALTDFPSQKAW
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) S

SS

SSSS



 .........290.........300.........310.........320.........330.........340.........350
Sequence LLADFDTRIGTAVEELVRWATPVMTFRRTAAADFELGGQLIRAGEKVVMFYASGNWDEDAFCHPERLDLS
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) T

B
SS
TT
TT
TT
TTT
SSTTS

TT
 .........360.........370.........380.........390.........400.........410....
Sequence RSPNPHVGFGGGGVHFCLGAHLARAQLRAIFGELLVQLPDIQAGDPVYVPGNFVHAIRSMPCTF
Predicted secondary structure









































SS confidence































































Known secondary structure (DSSP)
SS



TT
S
STT

TT
TT





SSB

B


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D