Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bkaA_

Fold library idPDB HeaderMoleculeTitle
c6bkaA_1.65PDB header: oxidoreductaseChain: A: PDB Molecule: nitronate monooxygenase;


Added to library: Sat Feb 17 08:28:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRSQIQSFLKTFEVRYPIIQAPMAGASTLELAATVTRLGGIGSIPMGSLSEKDAIETQLENFDELVGDSG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



T
SSS


TTT

TSB
TT
TT

TSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIVNLNFFAHKEPRSGRADVNEEWLKKYDKIYGKAGIEFDKKELKLLYPSFRSIVDPQHPTVRLLKNLKP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)







SS
T





S






GGG


TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence KIVSFHFGLPHEAVIESLQASDIKIFVTVTNLQEFQQAYESKLDGVVLQGWEAGGHRGNFKANDVEDGQL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SSS


TT

STT
S
TT
S


SSTT
TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence KTLDLVSTIVDYIDSASISNPPFIIAAGGIHDDESIKELLQFNIAAVQLGTVWLPSSQATISPEHLKMFQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
T
SS

SS

STTT
SSGGGTTSTTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence SPKSDTMMTAAISGRNLRTISTPFLRDLHQSSPLASIPDYPLPYDSFKSLANDAKQSGKGPQYSAFLAGS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S

S
STTTSS


T

GGGS
STTTT

GGG


B

T
 .........360.........370...
Sequence NYHKSWKDTRSTEEIFSILVQDL
Predicted secondary structure







SS confidence






















Known secondary structure (DSSP) TGGG


S


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D