Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bkaA_

Fold library idPDB HeaderMoleculeTitle
c6bkaA_1.65PDB header: oxidoreductaseChain: A: PDB Molecule: nitronate monooxygenase;


Added to library: Sat Feb 17 08:28:42 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MRSQIQSFLKTFEVRYPIIQAPMAGASTLELAATVTRLGGIGSIPMGSLSEKDAIETQLENFDELVGDSG
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)



T
SSS


TTT

TSB
TT
TT

TSS
 .........80.........90.........100.........110.........120.........130.........140
Sequence RIVNLNFFAHKEPRSGRADVNEEWLKKYDKIYGKAGIEFDKKELKLLYPSFRSIVDPQHPTVRLLKNLKP
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)







SS
T





S






GGG


TTS

 .........150.........160.........170.........180.........190.........200.........210
Sequence KIVSFHFGLPHEAVIESLQASDIKIFVTVTNLQEFQQAYESKLDGVVLQGWEAGGHRGNFKANDVEDGQL
Predicted secondary structure








































SS confidence





































































Known secondary structure (DSSP) SSS


TT

STT
S
TT
S


SSTT
TT



 .........220.........230.........240.........250.........260.........270.........280
Sequence KTLDLVSTIVDYIDSASISNPPFIIAAGGIHDDESIKELLQFNIAAVQLGTVWLPSSQATISPEHLKMFQ
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
T
SS

SS

STTT
SSGGGTTSTTS


 .........290.........300.........310.........320.........330.........340.........350
Sequence SPKSDTMMTAAISGRNLRTISTPFLRDLHQSSPLASIPDYPLPYDSFKSLANDAKQSGKGPQYSAFLAGS
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) S

S
STTTSS


T

GGGS
STTTT

GGG


B

T
 .........360.........370...
Sequence NYHKSWKDTRSTEEIFSILVQDL
Predicted secondary structure







SS confidence






















Known secondary structure (DSSP) TGGG


S


TT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D