Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bjbB_

Fold library idPDB HeaderMoleculeTitle
c6bjbB_1.50PDB header: transferaseChain: B: PDB Molecule: acetyl-coa acetyltransferase a;


Added to library: Sat Feb 10 08:48:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RPITDVVFVGAARTPIGSFRSAFNNVPVTVLGREALKGALKNANVKPSLVQEAFIGVVVPSNAGQGPARQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

GGG


TTSTTTT

T

GGG


S

TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VVLGAGCDVSTVVTAVNKMSASGMKAIACAASILQLDLQEMVVAGGMESMSCVPFYLPRGEIPFGGTKLI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

TT


GGGTTS
SSTT



SS


TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence DGIPRDGLNDVYNDILMGACADKVAKQFAITREEQDKYAILSYKRSAAAWKEGIFAKEIIPLEVTITVEE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTTTTT

TTTTTTTB





S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DEEYKKVNFEKIPKLKPAFTSEGSVTAANASTLNDGAAMVVMTTVDGAKKHGLKPLARMLAYGDAATHPI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSTT


TTTGGG


SSSTT
S

TTTB


T





GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence DFGIAPASVIPKVLKLAGLQIKDIDLWEINEAFAVVPLYTMKTLGLDESKVNIHGGAVSLGHPIGMSGAR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGGT

GGG
S

SBTT

GGGBSTT




 .........360.........370.........380....
Sequence IVGHLVHTLKPGQKGCAAICNGGGGAGGMIIEKL
Predicted secondary structure









SS confidence

































Known secondary structure (DSSP) S
TT
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D