Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bjbB_

Fold library idPDB HeaderMoleculeTitle
c6bjbB_1.50PDB header: transferaseChain: B: PDB Molecule: acetyl-coa acetyltransferase a;


Added to library: Sat Feb 10 08:48:59 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence RPITDVVFVGAARTPIGSFRSAFNNVPVTVLGREALKGALKNANVKPSLVQEAFIGVVVPSNAGQGPARQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)

GGG


TTSTTTT

T

GGG


S

TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence VVLGAGCDVSTVVTAVNKMSASGMKAIACAASILQLDLQEMVVAGGMESMSCVPFYLPRGEIPFGGTKLI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) TT

TT


GGGTTS
SSTT



SS


TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence DGIPRDGLNDVYNDILMGACADKVAKQFAITREEQDKYAILSYKRSAAAWKEGIFAKEIIPLEVTITVEE
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP) TTTTTTTT

TTTTTTTB





S
 .........220.........230.........240.........250.........260.........270.........280
Sequence DEEYKKVNFEKIPKLKPAFTSEGSVTAANASTLNDGAAMVVMTTVDGAKKHGLKPLARMLAYGDAATHPI
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP)
SSTT


TTTGGG


SSSTT
S

TTTB


T





GG
 .........290.........300.........310.........320.........330.........340.........350
Sequence DFGIAPASVIPKVLKLAGLQIKDIDLWEINEAFAVVPLYTMKTLGLDESKVNIHGGAVSLGHPIGMSGAR
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) GGGGT

GGG
S

SBTT

GGGBSTT




 .........360.........370.........380....
Sequence IVGHLVHTLKPGQKGCAAICNGGGGAGGMIIEKL
Predicted secondary structure









SS confidence

































Known secondary structure (DSSP) S
TT
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D