Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bjaA_

Fold library idPDB HeaderMoleculeTitle
c6bjaA_1.60PDB header: transferaseChain: A: PDB Molecule: acetyl-coa acetyltransferase a;


Added to library: Sat Feb 10 08:46:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KDVYILSAVRTPIASFRSTLTSLSAVDLGIVVTKEAIKRSLLPSSAIEETIVGNVLSAGLGQNIARQISI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




TTSTTTTS
TS
GGG


S

TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ASEIPKSSQCVTINKVSSSMKAIIMGAQAIQVGYRRIVVALGSESMSNAPFYVPRGEIPFGGVQLVDALQ
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT

TTS



TTS
SGGG



SS


TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence RDGLMDSIEYQPMGLCAEKTVKDYAFTREQLDAYAIESYRKAEHAWKEGAFNKEVVPVSVVVLTEDEEYK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTTTTTTTT

TTTTTTB




S
SGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence RLIPEKVPALHPAFLKDGSGTITAANASTINDGAAACVLASGEVVQEGRLKPIAKVLSYAEAGVEPIDFT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) G

GGGGGG


SS

SS




TTTB


T


S

GGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence VAPALAVKQLLSQSGLDEESIALWEINEAFSVTGLAFIKELRLDPKRVNVRGGAVALGHPLGASGARIVV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GT

GGG
S

SBT

GGGBSTT




 .........360.........370.........380.
Sequence TLVHALKSDELGVAAICNGGGEASAILIKKL
Predicted secondary structure









SS confidence






























Known secondary structure (DSSP) S
TT
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D