Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bjaA_

Fold library idPDB HeaderMoleculeTitle
c6bjaA_1.60PDB header: transferaseChain: A: PDB Molecule: acetyl-coa acetyltransferase a;


Added to library: Sat Feb 10 08:46:53 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence KDVYILSAVRTPIASFRSTLTSLSAVDLGIVVTKEAIKRSLLPSSAIEETIVGNVLSAGLGQNIARQISI
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)




TTSTTTTS
TS
GGG


S

TTS
S
 .........80.........90.........100.........110.........120.........130.........140
Sequence ASEIPKSSQCVTINKVSSSMKAIIMGAQAIQVGYRRIVVALGSESMSNAPFYVPRGEIPFGGVQLVDALQ
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TT

TTS



TTS
SGGG



SS


TT



 .........150.........160.........170.........180.........190.........200.........210
Sequence RDGLMDSIEYQPMGLCAEKTVKDYAFTREQLDAYAIESYRKAEHAWKEGAFNKEVVPVSVVVLTEDEEYK
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTTTTTTTT

TTTTTTB




S
SGGG
 .........220.........230.........240.........250.........260.........270.........280
Sequence RLIPEKVPALHPAFLKDGSGTITAANASTINDGAAACVLASGEVVQEGRLKPIAKVLSYAEAGVEPIDFT
Predicted secondary structure









































SS confidence





































































Known secondary structure (DSSP) G

GGGGGG


SS

SS




TTTB


T


S

GGGGG
 .........290.........300.........310.........320.........330.........340.........350
Sequence VAPALAVKQLLSQSGLDEESIALWEINEAFSVTGLAFIKELRLDPKRVNVRGGAVALGHPLGASGARIVV
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) GT

GGG
S

SBT

GGGBSTT




 .........360.........370.........380.
Sequence TLVHALKSDELGVAAICNGGGEASAILIKKL
Predicted secondary structure









SS confidence






























Known secondary structure (DSSP) S
TT
TTT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D