Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bhuA_

Fold library idPDB HeaderMoleculeTitle
c6bhuA_3.14PDB header: transport proteinChain: A: PDB Molecule: multidrug resistance-associated protein 1;


Added to library: Sat Dec 30 17:00:10 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP)

SST

T

 .........80.........90.........100.........110.........120.........130.........140
Sequence XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNDPNPCPESSASFLSRITFW
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP)

TTTGGGT




SS



T
 .........150.........160.........170.........180.........190.........200.........210
Sequence WITGMMVQGYRQPLESTDLWSLNKEDTSEQVVPVLVKNWKKECAKSPSLFKVLYKTFGPYFLMSFLFKAV
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP) TTS


STT




SSSS



SSGGGGSSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence HDLMMFAGPEILKLLINFVNDKKAPEWQGYFYTALLFISACLQTLVLHQYFHICFVSGMRIKTAVIGAVY
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP)
SSS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence RKALVITNAARKSSTVGEIVNLMSVDAQRFMDLATYINMIWSAPLQVILALYLLWLNLGPSVLAGVAVMV
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) TTB
S
TTSTT

 .........360.........370.........380.........390.........400.........410.........420
Sequence LMVPLNAVMAMKTKTYQVAHMKSKDNRIKLMNEILNGIKVLKLYAWELAFKDKVLAIRQEELKVLKKSAY
Predicted secondary structure


SS confidence





































































Known secondary structure (DSSP) TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence LAAVGTFTWVCTPFLVALSTFAVYVTVDENNILDAQKAFVSLALFNILRFPLNILPMVISSIVQASVSLK
Predicted secondary structure





SS confidence





































































Known secondary structure (DSSP) TT

SS


STTTT
 .........500.........510.........520.........530.........540.........550.........560
Sequence RLRVFLSHEDLDPDSIQRRPIKTNSITVKNATFTWARNDPPTLHGITFSVPEGSLVAVVGQVGCGKSSLL
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP) TS
B

GGGS

B



SSSSS

SS
SSS
STTSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence SALLAEMDKVEGHVTVKGSVAYVPQQAWIQNISLRENILFGRQLQERYYKAVVEACALLPDLEILPSGDR
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) TTT
SBS

SS



SSBSS



TT
SSSTTS
 .........640.........650.........660.........670.........680.........690.........700
Sequence TEIGEKGVNLSGGQKQRVSLARAVYCDSDVYLLDDPLSAVDAHVGKHIFENVIGPKGLLKNKTRLLVTHA
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)
B

SSSSSS
T
SS

SSSS
TTSTTSTTSSS


 .........710.........720.........730.........740.........750.........760.........770
Sequence ISYLPQMDVIIVMSGGKISEMGSYQELLARDGAFAEFLRETWKLVEADKAQTGQVKLSVYWDYMKAIGLF
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP)
TTGGGSSTT


TST













S



 .........780.........790.........800.........810.........820.........830.........840
Sequence ISFLSIFLFLCNHVASLVSNYWLSLWTDDPIVNGTQEHTQVRLSVYGALGISQGITVFGYSMAVSIGGIF
Predicted secondary structure






SS confidence





































































Known secondary structure (DSSP) T



STT
 .........850.........860.........870.........880.........890.........900.........910
Sequence ASRRLHLDLLHNVLRSPISFFERTPSGNLVNRFSKELDTVDSMIPQVIKMFMGSLFNVIGACIIILLATP
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) S
S
SS
 .........920.........930.........940.........950.........960.........970.........980
Sequence MAAVIIPPLGLIYFFVQRFYVASSRQLKRLESVSRSPVYSHFNETLLGVSVIRAFEEQERFIRQSDLKVD
Predicted secondary structure

SS confidence





































































Known secondary structure (DSSP) S

SSTTT
 .........990.........1000.........1010.........1020.........1030.........1040.........1050
Sequence ENQKAYYPSIVANRWLAVRLECVGNCIVLFASLFAVISRHSLSAGLVGLSVSYSLQVTTYLNWLVRMSSE
Predicted secondary structure




SS confidence





































































Known secondary structure (DSSP) TSSSS
 .........1060.........1070.........1080.........1090.........1100.........1110.........1120
Sequence METNIVAVERLKEYSETEKEAPWQIQDMAPPKDWPQVGRVEFRDYGLRYREDLDLVLKHINVTIDGGEKV
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP) TGGGTSS




S


SS


TT

SS



SSTTS

SS

B


TT

 .........1130.........1140.........1150.........1160.........1170.........1180.........1190
Sequence GIVGRTGAGKSSLTLGLFRIKESAEGEIIIDDINIAKIGLHDLRFKITIIPQDPVLFSGSLRMNLDPFSQ
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP)
TTSSSTTSS

SSS
BSTTS
TSS
SS



S
SS

 .........1200.........1210.........1220.........1230.........1240.........1250.........1260
Sequence YSDEEVWTSLELAHLKGFVSALPDKLNHECAEGGENLSVGQRQLVCLARALLRKTKILVLDQATAAVDLE
Predicted secondary structure






























SS confidence





































































Known secondary structure (DSSP) S
TT
SSSSS


TTTTSS


SSTTSSS
 .........1270.........1280.........1290.........1300.........1310.........1320........
Sequence TDDLIQSTIRTQFDDCTVLTIAHRLNTIMDYTRVIVLDKGEIQEWGSPSDLLQQRGLFYSMAKDSGLV
Predicted secondary structure



















SS confidence



































































Known secondary structure (DSSP) SSSS
S
GGGGTTSSSSSSB
S
B
TST


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D