Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bgiA_

Fold library idPDB HeaderMoleculeTitle
c6bgiA_3.80PDB header: membrane proteinChain: A: PDB Molecule: anoctamin-1;


Added to library: Sat Dec 30 08:32:14 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence NVEFNDRKLLYEEWASYGVFYKYQPIDLVRKYFGEKVGLYFAWLGAYTQMLIPASIVGVIVFLYGCATVD
Predicted secondary structure














SS confidence





































































Known secondary structure (DSSP)
T


SS

SS



TTT
 .........80.........90.........100.........110.........120.........130.........140
Sequence ENIPSMEMCDQRYNITMCPLCDKTCSYWKMSSACATARASHLFDNPATVFFSVFMALWAATFMEHWKRKQ
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP) TT
TTTTTGGGTTTTSS
SSSTTTTTTTTTTTTT
 .........150.........160.........170.........180.........190.........200.........210
Sequence MRLNYRWDLTGFIIFMIAVTFAIVLGVIIYRISTAAALAMNSSPSVRSNIRVTVTATAVIINLVVIILLD
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TS



TTTTTTT



SSSSSTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence EVYGCIARWLTKIEVPKTEKSFEERLTFKAFLLKFVNSYTPIFYVAFFKGRFVGRPGDYVYIFRSFRMEE
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TT

SSSTTTTTTS






SS
STTTT
 .........290.........300.........310.........320.........330.........340.........350
Sequence CAPGGCLMELCIQLSIIMLGKQLIQNNLFEIGIPKMKKFIRYLKLRRRYEVDFNLEPFAGLTPEYMEMII
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) S
SS


TT


SGGGSS




 .........360.........370.........380.........390.........400.........410.........420
Sequence QFGFVTLFVASFPLAPLFALLNNIIEIRLDAKKFVTELRRPVAIRAKDIGIWYNILRGVGKLAVIINAFV
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TS
SS
TTS










TTT
 .........430.........440.........450.........460.........470.........480.........490
Sequence ISFTSDFIPRLVYLYMYSQNGTMHGFVNHTLSSFNVSDFQNGTAPNDPLDLKYDISKDFWAVLAARLAFV
Predicted secondary structure







































SS confidence





































































Known secondary structure (DSSP) SSSSSTS
SS

GGGTTSSSS
SSS



TTTTTT
 .........500.........510
Sequence IVFQNLVMFMSDFVDWVIPD
Predicted secondary structure


SS confidence



















Known secondary structure (DSSP) S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D