Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6be6D_

Fold library idPDB HeaderMoleculeTitle
c6be6D_2.80PDB header: membrane proteinChain: D: PDB Molecule: disintegrin and metalloproteinase domain-containing protein


Added to library: Sat Dec 30 08:34:08 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRQISFMVKRIRINTTADEKDPT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




ST

BTTB




GGGGG
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TT

S


SS

TT
S




GGG





SSSS

SS



B

TTSS
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

STT

TT




STTT
GGG
SSTT


TT
SS


S
SG
 .........220.........230.........240.........250.........260.........270.........280
Sequence NNNKFSLCSIRQISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKL
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) GGGS

GGGT
B
S



SSSS


TT
S



SGGG


TTB

TTS
TTTTT
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence KPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPQFTDCNRHTQVCINGQC
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP)
SS



TTT
TTTTT

TT
BSS


SSB


B

SS
SS




B

SS

BTTTTBTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AGSICEKYGLEECTCASDKELCHVCCMKKMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVF
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) S
GGGGGT







TTB

TT
GGG
TTSSTTTT


B

TT
TTTT
TT
 .........430...
Sequence MRCRLVDADGPLG
Predicted secondary structure








SS confidence












Known secondary structure (DSSP) S



S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D