Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6be6D_

Fold library idPDB HeaderMoleculeTitle
c6be6D_2.80PDB header: membrane proteinChain: D: PDB Molecule: disintegrin and metalloproteinase domain-containing protein


Added to library: Sat Dec 30 08:34:08 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence EKNTCQLYIQTDHLFFKYYGTREAVIAQISSHVKAIDTIYQTTDFSGIRQISFMVKRIRINTTADEKDPT
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)




ST

BTTB




GGGGG
TT
 .........80.........90.........100.........110.........120.........130.........140
Sequence NPFRFPNIGVEKFLELNSEQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKS
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP)
TT

S


SS

TT
S




GGG





SSSS

SS



B

TTSS
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence LNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKL
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP)

STT

TT




STTT
GGG
SSTT


TT
SS


S
SG
 .........220.........230.........240.........250.........260.........270.........280
Sequence NNNKFSLCSIRQISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKL
Predicted secondary structure



















































SS confidence





































































Known secondary structure (DSSP) GGGS

GGGT
B
S



SSSS


TT
S



SGGG


TTB

TTS
TTTTT
B
 .........290.........300.........310.........320.........330.........340.........350
Sequence KPGKQCSPSQGPCCTAQCAFKSKSEKCRDDSDCAREGICNGFTALCPASDPKPQFTDCNRHTQVCINGQC
Predicted secondary structure



























































SS confidence





































































Known secondary structure (DSSP)
SS



TTT
TTTTT

TT
BSS


SSB


B

SS
SS




B

SS

BTTTTBTT
 .........360.........370.........380.........390.........400.........410.........420
Sequence AGSICEKYGLEECTCASDKELCHVCCMKKMDPSTCASTGSVQWSRHFSGRTITLQPGSPCNDFRGYCDVF
Predicted secondary structure

























































SS confidence





































































Known secondary structure (DSSP) S
GGGGGT







TTB

TT
GGG
TTSSTTTT


B

TT
TTTT
TT
 .........430...
Sequence MRCRLVDADGPLG
Predicted secondary structure








SS confidence












Known secondary structure (DSSP) S



S




Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D