Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bdtC_

Fold library idPDB HeaderMoleculeTitle
c6bdtC_2.30PDB header: hydrolaseChain: C: PDB Molecule: calpain-3;


Added to library: Sat Feb 10 08:28:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TT

TT




SSS
SS
SSS

SS



SS
BS
SS
S
GGG
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence ELGDSWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS

TTSS
S


SSSS

STT

TTSS
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence NHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGC
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSTTB
TTSSGGGSSB


GGG

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SIDDGTNMTYQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQVEWNGSWSDRWKDWSFVD
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


SSS
B


S
SSTTS

TT

TT
TTS




STTSTT
GGGGGS
 .........290.........300.........310........
Sequence KDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTA
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP) TT




SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D