Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bdtC_

Fold library idPDB HeaderMoleculeTitle
c6bdtC_2.30PDB header: hydrolaseChain: C: PDB Molecule: calpain-3;


Added to library: Sat Feb 10 08:28:49 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence GVKEKTFEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTDICQG
Predicted secondary structure












































SS confidence





































































Known secondary structure (DSSP)

TT

TT




SSS
SS
SSS

SS



SS
BS
SS
S
GGG
B

 .........80.........90.........100.........110.........120.........130.........140
Sequence ELGDSWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDDCLPTYNNQLVFTKS
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP) SS

TTSS
S


SSSS

STT

TTSS
B
 .........150.........160.........170.........180.........190.........200.........210
Sequence NHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFEIRDAPSDMYKIMKKAIERGSLMGC
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) SSTTB
TTSSGGGSSB


GGG

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence SIDDGTNMTYQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPWGQVEWNGSWSDRWKDWSFVD
Predicted secondary structure















































SS confidence





































































Known secondary structure (DSSP)


SSS
B


S
SSTTS

TT

TT
TTS




STTSTT
GGGGGS
 .........290.........300.........310........
Sequence KDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTA
Predicted secondary structure













SS confidence





































Known secondary structure (DSSP) TT




SS





Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D