Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bcqB_

Fold library idPDB HeaderMoleculeTitle
c6bcqB_3.25PDB header: transport proteinChain: B: PDB Molecule: transient receptor potential cation channel subfamily m


Added to library: Sat Dec 16 08:37:44 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PKIFRKKVCTTFITTEKPTDAYGDLDFTYSGRKHSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVVSVLG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT






TTS



SS

TTT




S

 .........80.........90.........100.........110.........120.........130.........140
Sequence GSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S
S


TT

BSSTS


S



GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence VRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) BSSGGG



SSS




S
S


SS
B
B
S

S
S
SSS


TSB
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence VGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEEARDRIRRYFPKGDPEV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSS
S
B


S

TT


B
SSS


TTTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS

B
TTS

STT

S
STT
SSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DIQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASHAPNV
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SS


TT
TTT

STTT

TT


TTSTT


 .........430.........440.........450.........460.........470.........480.........490
Sequence GQVLRTLLGETCAPRYAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAA
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
SSS




TT
SSSS
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence RRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKW
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
SSS
BTTTTTB
TT
TSS
 .........570.........580.........590.........600.........610.........620.........630
Sequence WGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQ
Predicted secondary structure


















SS confidence





































































Known secondary structure (DSSP) TTS
TT


GGGSSSSSS





TTTTTTTST


 .........640.........650.........660.........670.........680.........690.........700
Sequence PTKPSVSELLLYFWAFTLLCEELRQGLGLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRT
Predicted secondary structure







SS confidence





































































Known secondary structure (DSSP) SSS



S
SSSTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence VLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSIL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) TGGGSTTTGGGS

S


 .........780.........790.........800.........810.........820.........830.........840
Sequence RRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) TTTTT


STTS
GGGS



SSSS

SSSSS
SS
TTTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence LLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRLSKEAERKL
Predicted secondary structure










SS confidence





































































Known secondary structure (DSSP) SS
SS
TTTT


S
 .........920.........930.........940.........950.........960.........970.........980
Sequence LTWESVHKENFLLAQARDKRDSDSERLKRTSQKVDTALKQLGQIREYDRRLRGLEREVQHCSRVLTWMAE
Predicted secondary structure



SS confidence





































































Known secondary structure (DSSP) TS
 ...
Sequence ALS
Predicted secondary structure
SS confidence


Known secondary structure (DSSP)


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D