Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bcoD_

Fold library idPDB HeaderMoleculeTitle
c6bcoD_2.88PDB header: transport proteinChain: D: PDB Molecule: transient receptor potential cation channel subfamily m


Added to library: Sat Dec 16 08:45:38 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence PKIFRKKVCTTFITTEKPTDAYGDLDFTYSGRKHSNFLRLSDRTDPATVYSLVTRSWGFRAPNLVVSVLG
Predicted secondary structure


































SS confidence





































































Known secondary structure (DSSP)
TT






TT

S

SS

TT




S

 .........80.........90.........100.........110.........120.........130.........140
Sequence GSGGPVLQTWLQDLLRRGLVRAAQSTGAWIVTGGLHTGIGRHVGVAVRDHQTASTGSSKVVAMGVAPWGV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP)

S
S


TTT

BSSTS


SS


GGG
 .........150.........160.........170.........180.........190.........200.........210
Sequence VRNRDMLINPKGSFPARYRWRGDPEDGVEFPLDYNYSAFFLVDDGTYGRLGGENRFRLRFESYVAQQKTG
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) BTTTTS



SSS




S
S


SS
B
B
TT
S
S
SSS


TTTSB
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence VGGTGIDIPVLLLLIDGDEKMLKRIEDATQAQLPCLLVAGSGGAADCLVETLEEARDRIRRYFPKGDPEV
Predicted secondary structure

























SS confidence





































































Known secondary structure (DSSP) SSS
S
B


S

TTS


SSS

TTTT
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence LQAQVERIMTRKELLTVYSSEDGSEEFETIVLRALVKACGSSEASAYLDELRLAVAWNRVDIAQSELFRG
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP)
SS
SSS

STTT
S
STT
TSSS
 .........360.........370.........380.........390.........400.........410.........420
Sequence DIQWRSFHLEASLMDALLNDRPEFVRLLISHGLSLGHFLTPVRLAQLYSAVSPNSLIRNLLDQASHAPNV
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) SS


TT
TT



TT


TTSS



 .........430.........440.........450.........460.........470.........480.........490
Sequence GQVLRTLLGETCAPRYAPWSDLLIWALLLNRAQMAIYFWEKGSNSVASALGACLLLRVMARLESEAEEAA
Predicted secondary structure
















SS confidence





































































Known secondary structure (DSSP)
STT




TT
SS
S
S
 .........500.........510.........520.........530.........540.........550.........560
Sequence RRKDLAATFESMSVDLFGECYHNSEERAARLLLRRCPLWGEATCLQLAMQADARAFFAQDGVQSLLTQKW
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
SS
BTTTTTB
TT
TS
 .........570.........580.........590.........600.........610.........620.........630
Sequence WGEMDSTTPIWALLLAFFCPPLIYTNLIVFRKSKRWSDFWGAPVTAFLGNVVSYLLFLLLFAHVLLVDFQ
Predicted secondary structure



















SS confidence





































































Known secondary structure (DSSP) TTB
TT

SGGGGSSSSS
B


TTST


 .........640.........650.........660.........670.........680.........690.........700
Sequence PTKPSVSELLLYFWAFTLLCEELRQGLGLRHRLHLYLSDTWNQCDLLALTCFLLGVGCRLTPGLFDLGRT
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) SSS



TSSSTT
 .........710.........720.........730.........740.........750.........760.........770
Sequence VLCLDFMIFTLRLLHIFTVNKQLGPKIVIVSKMMKDVFFFLFFLCVWLVAYGVATEGILRPQDRSLPSIL
Predicted secondary structure









SS confidence





































































Known secondary structure (DSSP) TGGGSTTTGGGS

S


 .........780.........790.........800.........810.........820.........830.........840
Sequence RRVFYRPYLQIFGQIPQEEMDVALMIPGNCSMERGSWAHPEGPVAGSCVSQYANWLVVLLLIVFLLVANI
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP) GGGT


STTT
GGGS

SSSSS

SSSSS
SS
TTTT
 .........850.........860.........870.........880.........890.........900.........910
Sequence LLLNLLIAMFSYTFSKVHGNSDLYWKAQRYSLIREFHSRPALAPPLIIISHVRLLIKWLRRLSKEAERKL
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) SS
SS
GGGT


 .........920.........930.........940.........950..
Sequence LTWESVHKENFLLAQARDKRDSDSERLKRTSQKVDTALKQLG
Predicted secondary structure

SS confidence









































Known secondary structure (DSSP) TS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D