Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bc3A_

Fold library idPDB HeaderMoleculeTitle
c6bc3A_2.05PDB header: transferase/antibioticChain: A: PDB Molecule: aac 3-vi protein;


Added to library: Sat Mar 3 09:07:12 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPWSKSELVRQLRDLGVRSGDMVMPHVSLRAVGPLADGPQTLVDALIEAVGPTGNILAFVSWRDSPYEQT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

B
T

TT



BTTT
SS



TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LGHDAPPAAIAQSWPAFDPDHAPAYPGFGAINEFIRTYPGCRRTAHPDASMAAIGPDAAWLVAPHEMGAA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TT
SS




B
TTT



GGG
TTSTT

S
SSS
STTS


TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YGPRSPIARFLAHAGKILSIGAGPDAVTALHYAEAVARIEGKRRVTYSMPLLREGKRVWVTTSDWDSNGI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTTSTTT
B

GGG
TT


SS

TT
TT
S
 .........220.........230.........240.........250.........260........
Sequence LDEYAAPDGPDAVERIARDYLARTRVAQGPVGGAQSRLIDAADIVSFGIEWLEARHAA
Predicted secondary structure

















SS confidence

























































Known secondary structure (DSSP) SGGG

TTS

S

TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D