Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bc3A_

Fold library idPDB HeaderMoleculeTitle
c6bc3A_2.05PDB header: transferase/antibioticChain: A: PDB Molecule: aac 3-vi protein;


Added to library: Sat Mar 3 09:07:12 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TPWSKSELVRQLRDLGVRSGDMVMPHVSLRAVGPLADGPQTLVDALIEAVGPTGNILAFVSWRDSPYEQT
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)

B
T

TT



BTTT
SS



TT

 .........80.........90.........100.........110.........120.........130.........140
Sequence LGHDAPPAAIAQSWPAFDPDHAPAYPGFGAINEFIRTYPGCRRTAHPDASMAAIGPDAAWLVAPHEMGAA
Predicted secondary structure











































SS confidence





































































Known secondary structure (DSSP) TT
SS




B
TTT



GGG
TTSTT

S
SSS
STTS


TT
S
 .........150.........160.........170.........180.........190.........200.........210
Sequence YGPRSPIARFLAHAGKILSIGAGPDAVTALHYAEAVARIEGKRRVTYSMPLLREGKRVWVTTSDWDSNGI
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SSTTSTTT
B

GGG
TT


SS

TT
TT
S
 .........220.........230.........240.........250.........260........
Sequence LDEYAAPDGPDAVERIARDYLARTRVAQGPVGGAQSRLIDAADIVSFGIEWLEARHAA
Predicted secondary structure

















SS confidence

























































Known secondary structure (DSSP) SGGG

TTS

S

TTS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D