Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bbtB_

Fold library idPDB HeaderMoleculeTitle
c6bbtB_1.90PDB header: structural proteinChain: B: PDB Molecule: major pilin backbone protein t-antigen, t13;


Added to library: Sat Oct 27 08:25:07 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence TAGVVTGKTLPITKSMIYTDNEILMPKTTFTFTIEPDTTASGKLEIKSGETTGLTTKAIVSYDNTDKESA
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP)
TTSS



TTS




TT








TT



TT

GGG
 .........80.........90.........100.........110.........120.........130.........140
Sequence KNKTSNFNFETVTFSGIGIYRYTVSEQNDGIEGIQYDGKKWTVDVYVGNKFEPKYVVSKEVNSDVKKPIR
Predicted secondary structure































SS confidence





































































Known secondary structure (DSSP) S
TT


SSS




TT







TT


B

 .........150.........160.........170.........180.........190.........200.........210
Sequence FENSFKTTSLKIEKQVTGNQKDFNFTLILEASALYEKGQVVKIIQDGQTKDVVIGQEYKFTLHDHQSIML
Predicted secondary structure
































SS confidence





































































Known secondary structure (DSSP)








SSS
TT
TTTTS

TT
 .........220.........230.........240.........250.........260.......
Sequence AKLPIGISYKLTEDKADGYTTTATLKEGEIDAKEYVLGNLQKTDESADEIVVTNKRD
Predicted secondary structure






























SS confidence
























































Known secondary structure (DSSP) TT



TTTTS



TTS


SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions
Structural Biology Group logo Imperial logo
BBSRC logo
Phyre2 is part of Genome3D