Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bbqA_

Fold library idPDB HeaderMoleculeTitle
c6bbqA_35.00PDB header: lipid binding proteinChain: A: PDB Molecule: cytohesin-3,adp-ribosylation factor 6;


Added to library: Sat Jan 13 08:30:37 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MGHHHHHHGSTTQRNKQIAMGRKKFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGE
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)

S






TTSS

S
TT


 .........80.........90.........100.........110.........120.........130.........140
Sequence RDDFNIKVLQAFVELHEFADLNLVQALRQFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYV
Predicted secondary structure




















SS confidence





































































Known secondary structure (DSSP)
STS

TT

TTS



SSSTTSSS
 .........150.........160.........170.........180.........190.........200.........210
Sequence LSFAIIMLNTSLHNHNVRDKPTAERFITMNRGINEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTF
Predicted secondary structure

































SS confidence





































































Known secondary structure (DSSP)
TT

S


TTTTBTTB


S











SS
S
 .........220.........230.........240.........250.........260.........270.........280
Sequence FNPDREGWLLKLGGRVKTWKRRWFILTDNCLYYFEYTTDKEPRGIIPLENLSIREVEDPRKPNCFELYNP
Predicted secondary structure



































SS confidence





































































Known secondary structure (DSSP) S

S
SSS

TTSSTT
SS
S
BS


SSSSS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence SHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKSIKASISRDPFYDMLATRKRRIANKKGKV
Predicted secondary structure






































SS confidence





































































Known secondary structure (DSSP) SSTT





TTS



S

SS
B

T

T
 .........360.........370.........380.........390.........400.........410.........420
Sequence LSKIFGNKEMRILMLGLDAAGKTTILYKLKLGQSVTTIPTVGFNVETVTYKNVKFNVWDVGGLDKIRPLW
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) T


STTSSSS






SSTT

SGGGGGGG
 .........430.........440.........450.........460.........470.........480.........490
Sequence RHYYTGTQGLIFVVDCADRDRIDEARQELHRIINDREMRDAIILIFANKQDLPDAMKPHEIQEKLGLTRI
Predicted secondary structure























SS confidence





































































Known secondary structure (DSSP) GGG
TT

TT
GGGTSGGGTT

TTSTT


TTTTT
 .........500.........510.........520
Sequence RDRNWYVQPSCATSGDGLYEGLTWLTSNYK
Predicted secondary structure











SS confidence





























Known secondary structure (DSSP)
SS

BTTTTBT


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D