Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bbjC_

Fold library idPDB HeaderMoleculeTitle
c6bbjC_3.80PDB header: metal transportChain: C: PDB Molecule: transient receptor potential cation channel, subfamily v,


Added to library: Sat Mar 3 09:02:50 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MFNRHMLFDIVSRGSTAELEGFLPFLLAQKKRLTDEEFREASTGKTCLTKALMNLNGGKNDTIPMLIDIA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

ST
GGGGTTTT

TTSSTTS
TTT


S
SSS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence EKTGNLREFINSPFRDVYYRGQTALHIAIERRCKHYVELLVEKGADVHAQARGRFFQPKDEGGYFYFGEL
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) T
SS



SSTTTT

TT
T


TT




STTS
TTTT
S


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLSLAACTNQPDIVHYLTENAHKKADIRRQDSRGNTVLHALVAIADNTRENTKFVTKVYDLLVIKCVKLY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
S
SS



TT


TT


T

SSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PDSSLEAIFNNDSMSPLMMAAKLGKIGIFQHIIRLEIKDEEARHLSRKFRDWAYGPVYSSLYDLSMLDTC
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SS

GGG


TT


T
SS




GGGGGG
STT
TTTS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GEEVSVLEILVYNSKVENRHEMLAVEPINELLRDKWQKFGAVSFYISVVSYLIAMIIFTLIAYYRPMDGT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SSS

T


TTTTSTT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PPYPYRTTMDYMRLAGEIVTLLTGVVFFITNIKDLFMVNSLFIDGSFQLLYFIYSVLVIITAVLYLVGIE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
S







TTTS
TT
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence SYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMLQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCRDS
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TGGGGGGS



S

S





T
 .........500.........510.........520.........530.........540.........550.........560
Sequence STFSKFLLDLFKLTIGMGDLEMINSAKYPAVFIILLVTYIILTFVLLLNMLIALMGETVGQVSKESKQIW
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TST



SS

TTTSTTTTTTTTT
 .........570.........580.........590.........600........
Sequence KLQWATTILDIERSFPVCMRKAFRSGEMVTVGKRRWCFRVDEVNWSHW
Predicted secondary structure



















SS confidence















































Known secondary structure (DSSP) S
STTTTTS








SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D