Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6bbjC_

Fold library idPDB HeaderMoleculeTitle
c6bbjC_3.80PDB header: metal transportChain: C: PDB Molecule: transient receptor potential cation channel, subfamily v,


Added to library: Sat Mar 3 09:02:50 2018
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence MFNRHMLFDIVSRGSTAELEGFLPFLLAQKKRLTDEEFREASTGKTCLTKALMNLNGGKNDTIPMLIDIA
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)

ST
GGGGTTTT

TTSSTTS
TTT


S
SSS

T
 .........80.........90.........100.........110.........120.........130.........140
Sequence EKTGNLREFINSPFRDVYYRGQTALHIAIERRCKHYVELLVEKGADVHAQARGRFFQPKDEGGYFYFGEL
Predicted secondary structure





















































SS confidence





































































Known secondary structure (DSSP) T
SS



SSTTTT

TT
T


TT




STTS
TTTT
S


TT
 .........150.........160.........170.........180.........190.........200.........210
Sequence PLSLAACTNQPDIVHYLTENAHKKADIRRQDSRGNTVLHALVAIADNTRENTKFVTKVYDLLVIKCVKLY
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) TT
S
SS



TT


TT


T

SSTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence PDSSLEAIFNNDSMSPLMMAAKLGKIGIFQHIIRLEIKDEEARHLSRKFRDWAYGPVYSSLYDLSMLDTC
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP) SS

GGG


TT


T
SS




GGGGGG
STT
TTTS
S
 .........290.........300.........310.........320.........330.........340.........350
Sequence GEEVSVLEILVYNSKVENRHEMLAVEPINELLRDKWQKFGAVSFYISVVSYLIAMIIFTLIAYYRPMDGT
Predicted secondary structure

















SS confidence





































































Known secondary structure (DSSP) SSS

T


TTTTSTT



SS
 .........360.........370.........380.........390.........400.........410.........420
Sequence PPYPYRTTMDYMRLAGEIVTLLTGVVFFITNIKDLFMVNSLFIDGSFQLLYFIYSVLVIITAVLYLVGIE
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP)
S







TTTS
TT
T
 .........430.........440.........450.........460.........470.........480.........490
Sequence SYLAVMVFALVLGWMNALYFTRGLKLTGTYSIMLQKILFKDLFRFLLVYLLFMIGYASALVSLLNPCRDS
Predicted secondary structure











SS confidence





































































Known secondary structure (DSSP) TGGGGGGS



S

S





T
 .........500.........510.........520.........530.........540.........550.........560
Sequence STFSKFLLDLFKLTIGMGDLEMINSAKYPAVFIILLVTYIILTFVLLLNMLIALMGETVGQVSKESKQIW
Predicted secondary structure













SS confidence





































































Known secondary structure (DSSP) TST



SS

TTTSTTTTTTTTT
 .........570.........580.........590.........600........
Sequence KLQWATTILDIERSFPVCMRKAFRSGEMVTVGKRRWCFRVDEVNWSHW
Predicted secondary structure



















SS confidence















































Known secondary structure (DSSP) S
STTTTTS








SS


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D