Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b9tH_

Fold library idPDB HeaderMoleculeTitle
c6b9tH_2.35PDB header: oxidoreductaseChain: H: PDB Molecule: methylphosphonate synthase;


Added to library: Sat Dec 23 08:27:46 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence DSYLIRSGNNFLGILNDIKRRPEDAANELGVSIEEINSIISGKQKISPSLIEKAVNIWPVNERDFYIVSD
Predicted secondary structure






















SS confidence





































































Known secondary structure (DSSP)
TT

TS
TTSS


SS

GGGG




 .........80.........90.........100.........110.........120.........130.........140
Sequence DCSSGILIMTSQDSIKSSRIMERAGKPYYEYRDTAMSKTAPFRPEWILELCKVENNDPENPKAQWNNGHF
Predicted secondary structure


























SS confidence





































































Known secondary structure (DSSP)

TTS
T
TT



TTS


SS

TT
TT






S
 .........150.........160.........170.........180.........190.........200.........210
Sequence MHQFTYFIGEVNFYYKDPEGKKHVAIMNTGDSMYITPFTPHTFTTRDGASQNGLILALTYGSKLTGDIQQ
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP) SSS
TT



TT

TT

TT
SS



SSST
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELSSLSLDCGSQYALDFTNHENASLSLLEYYFELSNLTKEKFAKRTNFSMETLADFFTKKKLPTFDELKI
Predicted secondary structure
























SS confidence





































































Known secondary structure (DSSP) TS
TTS


SST

T

TTSS


 .........290.........300.........310.........320.........330.........340.........350
Sequence IAKALNVNSRDLMPNDLTESKVIVKTHDQCDHWKYPESGNYEFYELASTTALPHSKAFEIDVSSSEDLNL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TTS



SS


S
GGG

SSS
S



TTSTT


S



 .........360.........370.........380.........390.........400.........410.........420
Sequence DLKVGLHQYVYNIGDSALTINWNYENKTYQKSLNPGDSAYIKPFVPHNFRGNGKILILRIGGKISGDSQR
Predicted secondary structure




























SS confidence





































































Known secondary structure (DSSP)
B

SS
SSS
TT
TT

TT

S
TTTTT
 .........430.........440..
Sequence ELSFVGRENTQRAISETMQWFD
Predicted secondary structure


SS confidence





















Known secondary structure (DSSP)
GGGS

S
S


Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D