Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b9rD_

Fold library idPDB HeaderMoleculeTitle
c6b9rD_1.80PDB header: oxidoreductaseChain: D: PDB Molecule: hydroxyethylphosphonate dioxygenase;


Added to library: Sat Dec 23 08:29:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SDAARAARAAALLRAAANDLKRNDRAAEADLGLPPGSFGDYVSGRLPITWDLISRAAQAWPLNERDLLPI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

T

TTTSS


SS

GGGG


 .........80.........90.........100.........110.........120.........130.........140
Sequence HNDTPQGLRMMRVKESEASSRIIERGGGPYYEYRDTAMSRQASYRPEWISMLRVVEDDDPDNPLVEWNKG
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)



TTS
T
TT
S

TTS



B
SS

TT
TT





 .........150.........160.........170.........180.........190.........200.........210
Sequence HLLYQFTYFVGPVNYYFRSGGRSHCVPMNTGDSVWGLPFAPHSFTARSADEPAYILALTYGGELTGDAQR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
SSBSSTT

TT

TT

S
SSS

B

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELATFGRAVTSSLALTPGDHGAMLRSVMAARLTTVTELADRSGLKTDRVAALCRTPARAEWPELSALAEA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
T


TT
T




TT
SS


 .........290.........300.........310.........320.........330.........340.........350
Sequence LGVSVRELLVPHTTTEADVRIQPGRTASRWSYPGPDAPAYRFTQLAGDPLHPHTTSLAVDVLTARPDAPL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TS
GGGG






BTT
GGG

TT
S

TTSTT


SSS


B
 .........360.........370.........380.........390.........400.........410.........420
Sequence PPTYQHQYLYVLGEQPVSVRWRYNGEQYDGRLEPGDSAYVIPGIEFSLSAEKPTELLMLRIGGSATPDVR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


SS
SSS
TT
TT

TT


SS


S

 .........430.........440..
Sequence FALGAMPDGAIGRYIAEDRLWY
Predicted secondary structure










SS confidence





















Known secondary structure (DSSP) S
TT
S

S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is for non-commercial use only

Commercial users please contact Michael Sternberg

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D