Standard Mode | Switch to Expert Mode | Login to view past jobsRetrieve Phyre Job Id
 
Subscribe to Phyre at Google Groups
Email:
Visit Phyre at Google Groups
 Protein Homology/analogY Recognition Engine V 2.0


 

Fold library entry viewer: c6b9rD_

Fold library idPDB HeaderMoleculeTitle
c6b9rD_1.80PDB header: oxidoreductaseChain: D: PDB Molecule: hydroxyethylphosphonate dioxygenase;


Added to library: Sat Dec 23 08:29:32 2017
 
Links to external resources


 1........10.........20.........30.........40.........50.........60.........70
Sequence SDAARAARAAALLRAAANDLKRNDRAAEADLGLPPGSFGDYVSGRLPITWDLISRAAQAWPLNERDLLPI
Predicted secondary structure





















SS confidence





































































Known secondary structure (DSSP)
TT

T

TTTSS


SS

GGGG


 .........80.........90.........100.........110.........120.........130.........140
Sequence HNDTPQGLRMMRVKESEASSRIIERGGGPYYEYRDTAMSRQASYRPEWISMLRVVEDDDPDNPLVEWNKG
Predicted secondary structure




















































SS confidence





































































Known secondary structure (DSSP)



TTS
T
TT
S

TTS



B
SS

TT
TT





 .........150.........160.........170.........180.........190.........200.........210
Sequence HLLYQFTYFVGPVNYYFRSGGRSHCVPMNTGDSVWGLPFAPHSFTARSADEPAYILALTYGGELTGDAQR
Predicted secondary structure




































SS confidence





































































Known secondary structure (DSSP)
SSBSSTT

TT

TT

S
SSS

B

TTTT
 .........220.........230.........240.........250.........260.........270.........280
Sequence ELATFGRAVTSSLALTPGDHGAMLRSVMAARLTTVTELADRSGLKTDRVAALCRTPARAEWPELSALAEA
Predicted secondary structure



























SS confidence





































































Known secondary structure (DSSP)
T


TT
T




TT
SS


 .........290.........300.........310.........320.........330.........340.........350
Sequence LGVSVRELLVPHTTTEADVRIQPGRTASRWSYPGPDAPAYRFTQLAGDPLHPHTTSLAVDVLTARPDAPL
Predicted secondary structure










































SS confidence





































































Known secondary structure (DSSP) TS
GGGG






BTT
GGG

TT
S

TTSTT


SSS


B
 .........360.........370.........380.........390.........400.........410.........420
Sequence PPTYQHQYLYVLGEQPVSVRWRYNGEQYDGRLEPGDSAYVIPGIEFSLSAEKPTELLMLRIGGSATPDVR
Predicted secondary structure





























SS confidence





































































Known secondary structure (DSSP)


SS
SSS
TT
TT

TT


SS


S

 .........430.........440..
Sequence FALGAMPDGAIGRYIAEDRLWY
Predicted secondary structure










SS confidence





















Known secondary structure (DSSP) S
TT
S

S



Download:PDB structure FASTA sequence

Hidden Markov model

View in Jmol



Phyre is now FREE for commercial users!

All images and data generated by Phyre2 are free to use in any publication with acknowledgement

Please cite: The Phyre2 web portal for protein modeling, prediction and analysis
Kelley LA et al. Nature Protocols 10, 845-858 (2015) [paper] [Citation link]
 
© Structural Bioinformatics Group, Imperial College, London
Lawrence Kelley, Michael Sternberg 
Disclaimer
Terms and Conditions

Phyre2 is part of Genome3D